(data stored in ACNUC7421 zone)

EMBL: AM286690.PETC

AM286690.PETC        Location/Qualifiers
FT   CDS_pept        638181..638837
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="ABO_0580"
FT                   /product="ubiquinol-cytochrome c reductase cytochrome c1
FT                   subunit"
FT                   /function="component of the ubiquinol-cytochrome c
FT                   reductase complex (complex iii or cytochrome b-c1 complex),
FT                   which is a respiratory chain that generates an
FT                   electrochemical potential coupled to atp synthesis. c1
FT                   functions as an electron donor to cytochrome c."
FT                   /EC_number="1.10.2.2"
FT                   /note="(ubiquinol--cytochrome c reductase cytochrome c1)
FT                   identified by sequencesimilarity; putative InterPro:
FT                   Cytochrome c1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16028"
FT                   /db_xref="GOA:Q0VS20"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS20"
FT                   /protein_id="CAL16028.1"
FT                   /translation="MKKLAVILFSCLPLVAFAAGGGHNEYVVKAPVNLQDKVGLQNGAK
FT                   LFVNYCMGCHTLQYQRYSRMAEDLEMPEELVMENLNFVSDKFGDQMHNAMDQDDAKKWF
FT                   GNAPPDLTMVTRYRSSDWVYSYLINFYEDESRPFGYNNHVFPSVGMPHVMAGLEDELGE
FT                   DEFKQAMGDITNFLTYTAEPVRPQRERLGVYVLLFLGILLIPAYLLKKEYWKDVH"
     atgaagaaac tagcggttat tcttttcagc tgcctgccgt tggtcgcgtt cgcggctggc        60
     ggtggccaca acgagtacgt ggttaaagcg ccggtaaacc tgcaagataa ggttggcctg       120
     caaaatggtg ctaagttgtt cgttaactac tgcatgggtt gtcatactct ccagtaccag       180
     cgttacagcc gcatggcgga agatctggaa atgccagaag agctggtgat ggagaatctg       240
     aactttgtca gcgacaagtt cggtgaccag atgcataacg ccatggacca ggacgatgcg       300
     aagaagtggt ttggtaatgc tccgccggat ctcaccatgg tgacccggta ccgctcttcg       360
     gattgggtgt attcatacct gatcaacttc tacgaagatg agtctcgtcc atttggttac       420
     aataaccatg tcttcccgag tgtgggcatg ccccacgtga tggcgggctt ggaggacgag       480
     ctgggcgaag atgagttcaa gcaggcgatg ggtgacatca ctaacttcct gacctacacc       540
     gcggagccgg ttcgtccgca gcgtgaacgt cttggggttt atgtgctgct gttcttgggc       600
     atcctgttga tcccggctta cctgcttaaa aaggaatact ggaaagacgt acactga          657
//

If you have problems or comments...

PBIL Back to PBIL home page