(data stored in ACNUC7421 zone)

EMBL: AM286690.PFKB

AM286690.PFKB        Location/Qualifiers
FT   CDS_pept        complement(385842..386846)
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="ABO_0350"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /function="phosphorylates sugars in the presence of ATP and
FT                   magnesium"
FT                   /EC_number="2.7.1.4"
FT                   /note="(carbohydrate kinase, PfkB family) identified by
FT                   sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15798"
FT                   /db_xref="GOA:Q0VSQ0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ0"
FT                   /protein_id="CAL15798.1"
FT                   /translation="MTKKYDVYALGNALVDTEIEVSDAFLQRMEVDKGLMTLVDEARQA
FT                   ELLEALTDEAEPRKQTSGGSACNTVVATRYFGGNSYYACKVADDTTGSIFVDDLTTAGV
FT                   DTNMNGPRDSGVSGKCLVMLTPDAERTMNTHLGISSQVSNAELDEAAIAASHYVYLEGY
FT                   LVSGDSSRAAAIKLRQLAEKHGIKTSLTFSDPAMVQFFKDGLNEMLGERVDLLFCNEAE
FT                   ATSFTGTDNVDTALAALKSRCGSAVITLGAEGALAWDGEHTHRIDPVPVKAIDTNGAGD
FT                   MFAGAFLYAITHGHDFVAAGKLASAASARLVSEFGPRLPAEVHLQLRKATLGE"
     atgacaaaga aatatgacgt ttacgccctc ggtaatgccc tagtagacac ggaaatcgag        60
     gtcagcgacg ccttcttaca gcgtatggaa gtagacaaag gcctaatgac gttagtggat       120
     gaagcccgcc aggcagaact gcttgaagct ctcaccgatg aagccgaacc ccgcaagcaa       180
     accagcggcg gctccgcttg caacaccgtg gtcgccaccc gctatttcgg cggtaatagt       240
     tactacgcct gcaaagtggc cgacgatact accggcagca tctttgtcga tgacctaacc       300
     actgccggtg tggacaccaa catgaatggg ccgcgagaca gcggcgtttc cggcaaatgc       360
     ctggtgatgt tgaccccgga tgccgagcgc accatgaaca cccacctagg catttcaagc       420
     caagtgtcca acgcagaact ggacgaggcg gccatcgctg ccagccacta tgtgtaccta       480
     gaaggctatt tggtcagcgg cgacagctcc cgggctgctg ccatcaaact ccgccagctg       540
     gccgagaagc acgggattaa aacttcactg accttctccg atccagccat ggtccagttt       600
     ttcaaagacg gcctgaatga aatgctcggc gaacgcgtag acttgttgtt ttgcaacgaa       660
     gccgaagcca ccagctttac tggcaccgat aatgtagaca cagctttggc ggcgcttaaa       720
     tcacgctgcg gctccgccgt gataaccctc ggcgctgagg gcgccttggc ttgggatggt       780
     gaacacacac accggattga tccggttccg gtaaaagcca tcgataccaa cggggccggc       840
     gacatgtttg ccggcgcttt cctgtatgcc attacccacg gccatgactt tgtcgccgca       900
     gggaaattgg cctcagccgc ctctgcgcgt ctcgtcagcg aatttggccc gcgcttgccg       960
     gctgaggttc acctgcagct tcgcaaagcc acgctaggcg aatag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page