(data stored in ACNUC7421 zone)

EMBL: AM286690.PGM

AM286690.PGM         Location/Qualifiers
FT   CDS_pept        complement(228475..230829)
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="ABO_0211"
FT                   /product="Phosphoglucomutase/phosphomannomutase"
FT                   /function="d-mannose 1-phosphate = d-mannose 6-phosphate /
FT                   d-glucose 1-phosphate = d-glucose 6-phosphate."
FT                   /EC_number="5.4.2.2"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Phosphoglucomutase and phosphomannomutase family"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15659"
FT                   /db_xref="GOA:Q0VT61"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT61"
FT                   /protein_id="CAL15659.1"
FT                   /translation="MKQLLPLVTAGIIGVIAATGCLYVYQIKQLQPEQQHTQAQLLARS
FT                   LANQVHSTIEISRKQLDILSNRRDANRALADNDLSSFNMHQQQWFPEASVQLISHRDSD
FT                   MSRLSYTAQELLKKASLGQKPEPVIIAGDIPRLVIARATHNEFGSLLLTQSLVPLATAL
FT                   RASIPNGGALAVKYAGTPLLNNKQRASGGTAQVTQGPVEVSLALRAHSDNSLIVAILGV
FT                   SLGAVAILLTTLLVNRLLNRALRQDVAELIRYSDELIHQPGVTARDHFQFPVLKGANEA
FT                   SARLAQKLRERAGATRPHAAAQTDALLVEENDDDSILLIDDDGGDQAVPDSIFRAYDIR
FT                   GIAGDTLTAQGTYLLGRAIGSEAGELGQQTVLVARDGRLSSPELSRSLIKGLLESGRDV
FT                   VNLGLVPTPVLYYATEVLETQTGIMLTGSHNPPQHNGLKIVMNGDTLYGERILALSQRI
FT                   KNNAFSEGRGHEEERDIADRYLNDIASDIVLARPLKIAIDCGNGATGELAPRLFSQLGC
FT                   EVAPLYTEIDGNFPNHAPDTGNPDNLTDLIRVVQEQELDLGLAFDGDGDRVAVVTNTGE
FT                   IIWPDRLLMLFAKDLLARSPGADILFDVKCSRALPAIIRKNGGRPLMYKTGHSLIKAKM
FT                   KESGTALAGEISGHIFFADRWFGCDDGAYAGARLLEILSLQDDTAGQVFDQFQTGATTP
FT                   ALYIDATDDNKFALIDALEAHADQFTGGRPTTIDGLRVDFPDGWGLVRASNTTPSLVAR
FT                   FEGRDEEALERVKEQFRKQLHAIDKSLKLPF"
     atgaagcaac tgctgccctt ggttacagcg ggcattatcg gggtaattgc ggccaccggc        60
     tgcctttacg tctatcaaat aaagcaatta caacccgaac aacagcatac tcaggctcaa       120
     ttgttggctc gctctttggc caatcaagtc catagcacga tcgagatatc acgtaagcaa       180
     ctggacattc tcagtaaccg ccgcgacgca aaccgcgctc tggcagacaa tgacctgtcc       240
     agcttcaaca tgcatcagca gcaatggttc cccgaagcct cagtccagtt aatttcccac       300
     cgtgattcag atatgtcccg gctcagctac acggcccaag agctactcaa gaaggccagc       360
     ttgggccaaa agcccgagcc cgtcatcatt gccggcgaca taccccggct agtgatcgct       420
     cgcgccaccc acaacgaatt tggcagccta ctgctcaccc agtccttagt tccgctggct       480
     accgccctgc gcgcgtctat cccaaacggt ggtgcgctcg ccgtgaaata cgctggcacc       540
     cctctgctca acaacaagca acgcgccagc ggcggcaccg ctcaggtcac gcaaggcccg       600
     gttgaagtca gcctagcact acgcgcgcac agcgataata gcctgattgt cgccatcctt       660
     ggcgtctccc tgggtgcagt tgccatcctc ctaaccaccc tgctggtcaa ccgcctgctg       720
     aaccgagccc tgcgacaaga cgtcgccgag ctaatccgct acagcgacga actcatacac       780
     caaccgggtg tcaccgcccg cgaccatttc cagtttccag ttttaaaagg cgctaacgaa       840
     gcctccgccc ggctggccca aaaattacgc gagcgcgcag gcgccactcg tccccatgcc       900
     gcagcccaaa ccgacgcctt gctagtggag gaaaatgacg acgatagcat tctactaata       960
     gatgacgatg gcggtgacca agctgtaccc gacagcattt ttcgcgctta cgacatccgc      1020
     ggcatagccg gcgacaccct aaccgctcaa ggcacctacc tgctaggacg cgccatcggc      1080
     agcgaagccg gcgaactggg ccagcaaaca gtgctggtgg cccgcgatgg ccgcctttcc      1140
     agcccggaac tcagccgctc attaatcaaa ggcctgctag aatccggccg cgacgtggtt      1200
     aacctgggcc tagtccccac tccggttctc tactatgcca ccgaagtact agaaactcag      1260
     accggcatca tgctcaccgg cagccacaac ccgccccagc ataacggcct aaaaatcgtc      1320
     atgaacggcg acactcttta cggcgaacgc atcctagccc ttagccagcg catcaaaaac      1380
     aatgccttta gcgaaggccg cggccacgaa gaagaacgcg acatcgccga tcgctatctc      1440
     aacgacattg ccagcgacat cgtgctggcc cgccccctaa aaattgccat cgactgcggc      1500
     aacggtgcca ctggcgaact ggcgccacgc ctgttcagcc agttaggatg tgaagttgcg      1560
     ccactgtata cagagatcga cggaaacttc cccaaccacg ccccagacac cggtaacccg      1620
     gataacctca ccgacctgat ccgcgtagta caggaacagg aactggacct gggcctagcc      1680
     ttcgatggcg acggcgaccg cgtcgcagtg gttaccaaca ccggcgaaat catctggccc      1740
     gatcgcctgc taatgctgtt cgccaaagac ctgctcgccc gcagccccgg cgccgacatc      1800
     cttttcgacg taaaatgcag ccgcgccctg cctgccatta tccgcaagaa cggaggccgt      1860
     ccattgatgt acaaaacagg gcactcgcta atcaaggcca aaatgaaaga aagtggtacc      1920
     gccttggcgg gtgaaatcag cggccacatc ttcttcgccg accgctggtt cggctgcgat      1980
     gacggcgcct atgcgggagc tcgcctgctg gaaatccttt cattgcaaga tgacaccgcc      2040
     ggccaagtat tcgaccaatt tcaaaccggc gccaccaccc cagcgttgta tatcgatgcc      2100
     accgacgaca acaaatttgc actgatcgac gccctcgagg cccatgccga ccaattcacc      2160
     ggcggccgcc ccaccaccat cgacgggcta cgggtggact ttcctgatgg ctgggggctg      2220
     gtgcgcgcgt ccaacaccac cccgtcactg gtggcccgct tcgaagggcg cgacgaagag      2280
     gcactggaac gagtaaaaga acagttccgc aaacaactgc atgcaatcga taaaagccta      2340
     aaattgccgt tttga                                                       2355
//

If you have problems or comments...

PBIL Back to PBIL home page