(data stored in ACNUC7421 zone)

EMBL: AM286690.PILG

AM286690.PILG        Location/Qualifiers
FT   CDS_pept        complement(117480..117863)
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="ABO_0109"
FT                   /product="type IV pili response regulator PilG"
FT                   /function="response regulator involved in signal
FT                   trasduction for pilus-biosynthesis"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Response regulator receiver domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15557"
FT                   /db_xref="GOA:Q0VTI6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTI6"
FT                   /protein_id="CAL15557.1"
FT                   /translation="MTDNFQDLKVMVIDDSKTIRRTAETLLKKAGCEVITATDGFDALA
FT                   KIADSKPHIIFVDIMMPRLDGYQTCALIKNNSAFKATPVIMLSSKDGLFDKAKGRIVGS
FT                   DEYLTKPFSKDELLGAIRQHING"
     atgactgaca atttccaaga cctcaaggta atggtaatcg acgattccaa gacgattcgt        60
     cgtaccgccg agactttgtt aaagaaagca ggctgtgaag taatcacggc caccgatggc       120
     ttcgatgcct tggccaaaat cgccgacagc aagccccata tcattttcgt cgatatcatg       180
     atgccgcgtc tcgatggtta tcagacctgc gcgctgatca aaaataatag cgccttcaag       240
     gcaaccccgg tgatcatgct gtcgtccaaa gatggcctgt ttgacaaggc caagggacgc       300
     atcgttggtt ccgatgagta cctgaccaag ccgttttcca aagacgagct tttgggtgcc       360
     attcgtcagc atatcaatgg ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page