(data stored in ACNUC7421 zone)

EMBL: AM286690.PILS

AM286690.PILS        Location/Qualifiers
FT   CDS_pept        complement(512826..514460)
FT                   /transl_table=11
FT                   /gene="pilS"
FT                   /locus_tag="ABO_0472"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF04306 InterPro: Histidine kinase C-terminal"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15920"
FT                   /db_xref="GOA:Q0VSC8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSC8"
FT                   /inference="protein motif:HMMPFAM:HMMPF04306"
FT                   /protein_id="CAL15920.1"
FT                   /translation="MFQPPTLLVMAGCISAAKNISANIWNSMIASQGWTPARIYNVYRI
FT                   AIACVLLLLHYGSDKALLGTHFPALFETTLFVYLGLTLASATLDNNRHRRAFPAWAQPA
FT                   ALISDLGMLTLVVHSNGGLEGGLAVLLLVTVAAGNILLRGRQGFLIAALATLSAMFEQF
FT                   YFSIHTQHSSPFVLTESSLLGIAFFMVSLIIQQIAHRLEQSEKVTRQQQVAIERLEALN
FT                   QQIVQRMRTGVLVFDDGFQVLMSNQSANNLFDSPMLGKHLPDALASRFHRWQDNPLLPL
FT                   PTLRVSEQSPVLSPRFAQLDTGHENLTLLFLENTAQIAQEAQQMNLASLGRLSATLAHE
FT                   IRNPLSAINHASDLLLDGDPSQEDQHLLQIIRNHVTRVNGIIHDVLDLSRRPKGQAERF
FT                   ILPTLIQEVTEQWKIKNTTGRIALHCQPDMEVRFDRSQLIQVLDNLIGNALRHGGDFCE
FT                   VSLHCGHHDRTGLPWLRVQDNGQGISFEARDYLFEPFYTTAKDGNGLGLYLCRELCHAN
FT                   QATLDLEESSKGASFVITFAHPHRQFQ"
     atgttccagc ccccgacgct tttagtcatg gcgggctgca tttctgcagc caagaacatc        60
     agcgccaata tctggaacag catgatcgct agccaaggct ggacaccggc acgcatctat       120
     aatgtttacc gcattgccat agcttgcgtg ctgctattac tacactacgg gtcagataag       180
     gctctgctcg gcacccattt ccccgccctc ttcgaaacaa ccctttttgt ctacttgggc       240
     ctgacgctgg cctccgccac cctggacaat aaccggcata gacgagcatt tcctgcctgg       300
     gcacaaccgg ccgcgctcat cagtgacctc gggatgctaa cactggtagt gcattccaat       360
     ggcggactag aaggcggtct tgcggtgctt ttgttggtga ccgttgcggc tggcaacatt       420
     cttttacgcg gtcgacaagg ctttcttatc gcggcactgg caaccctgtc cgccatgttc       480
     gagcagttct atttttccat ccatacacag cactcatccc cgttcgtgct gactgaatcg       540
     agcctgctcg gcattgcctt cttcatggta tcgctgatta ttcagcaaat cgcgcatcgc       600
     ctagaacaaa gcgaaaaagt cacgcggcag caacaggttg ctattgaacg actggaagca       660
     ctgaaccaac aaattgtgca acgtatgcgc acaggcgttt tggtgttcga cgacggtttt       720
     caagttctca tgtccaacca gtccgccaac aatctgttcg acagcccgat gctaggcaag       780
     cacctacccg acgcattagc ctcccgtttt catcgttggc aagataatcc ccttctgcct       840
     ttacctaccc tgcgcgtctc ggagcagtct cccgtgctga gcccacggtt cgcacagctg       900
     gataccggac atgaaaacct gacactgctt tttctagaga acaccgcaca aatcgcacag       960
     gaagcccagc aaatgaacct agcttctctc gggcgcctat ctgccaccct agcccatgaa      1020
     atccgcaatc ctctcagtgc cattaatcat gcctccgatc tcttgcttga tggagaccca      1080
     agccaggaag accagcacct attacaaata atccgcaacc atgtaactcg ggtgaacggc      1140
     attattcatg atgtactaga cctttcacgc agaccgaaag ggcaagctga acgattcatt      1200
     ctgccaacac taattcagga agtaactgag caatggaaaa tcaaaaacac caccggacga      1260
     attgctcttc attgccaacc ggatatggaa gtgcgctttg atcgcagtca gctgatccag      1320
     gtgctggata acctgatcgg caatgcactg cgccatggcg gcgatttctg cgaggtgagt      1380
     ctgcattgtg gccaccatga tcgtaccggt cttccttggc taagagttca agataacggc      1440
     cagggtatca gctttgaggc cagggattat ctcttcgagc ccttttacac caccgccaaa      1500
     gacggcaatg gccttggcct ttatctgtgc cgcgaactgt gccatgccaa ccaagccaca      1560
     ctagacctgg aggaaagctc gaaaggagcc agctttgtga taacctttgc tcacccgcac      1620
     cgacaatttc aataa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page