(data stored in ACNUC7421 zone)

EMBL: AM286690.PLSC

AM286690.PLSC        Location/Qualifiers
FT   CDS_pept        complement(6806..7534)
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="ABO_0006"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase,
FT                   putative"
FT                   /function="catalyzes the acylation of
FT                   1-acyl-sn-glycerol-3-phosphate to phosphatidic acid"
FT                   /EC_number="2.3.1.51"
FT                   /note="identified by sequence similarity"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15454"
FT                   /db_xref="GOA:Q0VT25"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT25"
FT                   /protein_id="CAL15454.1"
FT                   /translation="MTPHAPPSLSIKVRSALFFVLYSLTGIFHSFLCVLIGPFLPRHAR
FT                   HRFINQWTRFAMWLDQRLNRITVTLEGHEHLSEDPCVILANHQSSWETFYLQVLISPQA
FT                   TVLKRELLWIPFFGWGLALLNPIRINRSDGNGALKSVLSQGKQRLKSGLRVVIFPEGTR
FT                   QPPGTLGKFNHGGSLLASQAGVPVIAISHNSGNCWPRKTWIRYPGTITLRISPPISTEN
FT                   KKAKQITAEVHQWIVDHYPS"
     atgaccccgc acgctccacc gtcgctgtcg atcaaggtcc gcagcgcact tttttttgtg        60
     ctatatagcc tgaccggcat ttttcacagt ttcttatgcg tgcttatcgg cccatttctg       120
     ccacggcatg cgcggcaccg gtttattaat cagtggactc gttttgccat gtggctcgac       180
     cagcggctaa accgtattac cgtaacgtta gaaggccacg aacacctcag cgaagaccct       240
     tgcgtcattc tcgctaacca tcaaagcagc tgggaaacat tttacctaca ggtactcatc       300
     agcccgcaag ccaccgtgtt gaaaagggaa ctcctttgga ttcccttctt cggctggggt       360
     ttagcgttgc ttaatcccat tcgcatcaac cgaagtgatg gcaatggtgc gctgaaatcc       420
     gttctttccc aaggcaaaca acgcctcaag agcggcctgc gtgtggtcat ttttccggaa       480
     ggaacacgac aaccacccgg tacgctaggc aagttcaacc acggcggcag tttgctggca       540
     agccaagcag gtgtacccgt gatagccatt tcccataaca gtggaaattg ctggccacga       600
     aaaacctgga tccgttatcc aggtactatc accttgcgca taagcccccc catttcgacc       660
     gaaaataaaa aagccaagca aataaccgct gaagtacacc aatggatagt ggatcattac       720
     ccaagctaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page