(data stored in ACNUC7421 zone)

EMBL: AM286690.PRFA

AM286690.PRFA        Location/Qualifiers
FT   CDS_pept        575060..576145
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="ABO_0523"
FT                   /product="peptide chain release factor 1"
FT                   /function="peptide chain release factor 1 directs the
FT                   termination of translation in response to the peptide chain
FT                   termination codons uag and uaa"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Peptide chain release factor 1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15971"
FT                   /db_xref="GOA:Q0VS77"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS77"
FT                   /protein_id="CAL15971.1"
FT                   /translation="MKASLQGKLDKLADRFEELAGLLSDPDVISNQNQFRDLSREYAEI
FT                   DPVVKCYRQYQQAVEDHGAAKAMQDDSDADMREMGAEEARDAQERMEALAAELQKLMLP
FT                   KDPRDGANVFLEVRAGTGGDEAAIFAGDLFRMYSKYADQRGWKVEMVSASEGEHGGYKE
FT                   VIARVIGDGVYSRMKFESGAHRVQRVPATESQGRIHTSACTVAIMAEAEDLGDIKIRTE
FT                   DLRIDTYRSSGAGGQHVNTTDSAVRITHLPTGVVVECQDERSQHKNKARAMSLLSAKLY
FT                   DAQQNAAHAEQAAERKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYRLNEIVEGDLD
FT                   EILGALLAEYQADQLAALGEH"
     atgaaagcgt cattgcaagg caagctcgat aagcttgcag accggtttga agagttggcg        60
     gggctattgt ccgatccgga tgtgattagc aaccagaacc aattccgtga cctgtcccgg       120
     gaatacgctg aaattgatcc agtggtgaag tgttatcgcc aataccagca ggccgtggag       180
     gatcatggtg cggctaaagc gatgcaggac gacagcgacg cggatatgcg tgagatgggc       240
     gcggaagaag cccgtgatgc tcaggagcgc atggaggcgt tagcggcaga gctgcaaaag       300
     ctgatgctac cgaaggatcc ccgcgatgga gccaatgtgt ttcttgaagt tcgcgccggc       360
     acgggggggg acgaagcggc catttttgcc ggagacctat tccgcatgta ttccaagtat       420
     gcggatcaac ggggttggaa agtggagatg gtgagcgcca gtgagggcga gcatggcggc       480
     tataaggaag tgattgcacg ggtgattggc gatggcgtct attcgcggat gaaatttgaa       540
     tccggagccc accgggtgca acgggtgccg gccacagaat cccaggggcg tattcatacc       600
     tctgcctgca cagtggcgat tatggctgaa gcggaagacc tgggggatat caagattcgc       660
     actgaagacc tgcgtattga tacctatcgt tcctccggtg ctggcggtca gcacgttaac       720
     accacggatt cggctgtgcg cattactcac ttacccaccg gggtggtggt ggagtgccag       780
     gatgagcgta gccagcacaa gaacaaggct cgggctatga gcctactgag cgctaagctg       840
     tatgacgcgc agcagaatgc ggcccatgcc gagcaggctg cggagcgtaa atccctcgtc       900
     gggtccggcg atcgttcaga gcgtatccgt acctataact atcctcaggg acgagtcact       960
     gatcatcgta ttaatcttac cctttaccgg ttaaatgaaa tcgttgaagg agatttggat      1020
     gagattttgg gtgcgttgct ggcagagtat caggcggatc agctagcggc cttaggcgag      1080
     cattaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page