(data stored in ACNUC7421 zone)

EMBL: AM286690.PRLC

AM286690.PRLC        Location/Qualifiers
FT   CDS_pept        149951..151984
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="ABO_0140"
FT                   /product="oligopeptidase A"
FT                   /function="may play a specific role in the degradation of
FT                   signal peptides after they are released from precursor
FT                   forms of secreted proteins. can cleave N-acetyl-L-ala4.
FT                   hydrolysis of oligopeptides, with broad specificity. gly or
FT                   ala commonly occur as p1 or p1' residues, but more distant
FT                   residues are also important, as is shown by the fact that
FT                   z-gly-pro-gly-|-gly-pro-ala is cleaved, but not z-(gly)5."
FT                   /EC_number="3.4.24.70"
FT                   /note="identified by sequence similarity; putative
FT                   identified by match to PFAM protein family HMMPF01432
FT                   InterPro: Peptidase family M3"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15588"
FT                   /db_xref="GOA:Q0VTD2"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTD2"
FT                   /inference="protein motif:HMMPFAM:HMMPF01432"
FT                   /protein_id="CAL15588.1"
FT                   /translation="MSNNPLIDYPALPPFSQIRPEHVLPAVEQLVAEGRARIEQVLAEG
FT                   NFDYDHLVQALDQEDDRLGKAFGPAGHLNAVAQNETLRNAYNSCLPLLSEYGTEVGQNT
FT                   ALCAAYQALRDSDQWATLSEAQQKDIDNTLRDFRLSGVDLPEEKKTQYMENSKRLSELT
FT                   SKFSDNALDATQAWSKHITDENELDGLPESAKAGAADRAKAEDKEGWLLTLDAPVFIAV
FT                   MSHCKNAELRKEIYTAWTTKASDQGPQAGQFDNAKIIDEILALRHQQAQLLGFANYAEK
FT                   SLATKMARDVSEVVQFLEDLARRAKPQAEQELAELKAFAAEQGVGDLNPWDIGFWSERL
FT                   REARYDISEEELRPWFPADTVINGMFSVVGKLFGIQFKQRKDVDTWHEDVRFYELVDDD
FT                   GGVRAAFYLDMYARTGKRGGAWMDDARIRRRQPDGSVQTPVAYLTCNFAPPAGGKPGLL
FT                   THDEVVTLFHEFGHGLHHMLTEQDVSGISGINGVAWDAVELPSQFLENWCWTEEGIALI
FT                   SGHYQTGEPLPKEKLEKMLAAKNFQGAMQMVRQIEFSLFDMRIHAEYQPGLNIYQILDE
FT                   VREQVAVIRPPSFNRFPNSFGHIFAGGYAAGYYSYKWAEVLSADAYSRFEEEGEFNEET
FT                   GRAFRTEILAKGGSREPMELFKAFRGREPSVEPLLRHCGING"
     atgagcaaca atccgctgat tgattatcca gcacttcccc ctttttcaca gatccggcca        60
     gaacatgttc tccctgccgt ggagcagctg gtagcagagg gccgtgcccg tatcgagcag       120
     gtgctggccg aaggtaattt cgattatgac cacctggtac aggcattgga tcaggaagat       180
     gaccgtctcg gtaaagcatt tggcccggcc gggcatttga atgccgtggc ccagaatgaa       240
     accttgcgta atgcctataa tagttgcctg ccgctgctta gcgaatacgg tactgaagtg       300
     gggcagaata cggccctttg tgctgcctat caggcgctgc gcgatagcga tcagtgggcc       360
     acgctgagtg aagcccagca aaaagatatc gacaatactc tgcgcgattt ccgtttgtcc       420
     ggtgtggact tgccggaaga aaagaaaacg caatacatgg aaaattcaaa acggttatct       480
     gagttgacca gcaaattctc ggataacgcg cttgatgcta ctcaagcatg gagcaaacac       540
     atcaccgatg aaaatgaact cgatggcttg cccgaaagcg cgaaggccgg cgccgcagat       600
     cgggctaaag cagaggacaa agagggttgg ctactgaccc tggacgcccc ggtttttatt       660
     gcggtgatga gccactgtaa gaacgcagaa ctgcgtaaag agatatatac cgcttggacc       720
     accaaggcct ctgatcaagg tccacaagct ggccaatttg ataatgcgaa aattatcgat       780
     gagatcctgg cgctgcgaca tcaacaggct cagctattgg gtttcgctaa ctacgcggaa       840
     aagtctttgg cgacgaaaat ggccagagat gttagtgagg ttgtacagtt tctcgaagac       900
     ttggcgcgcc gcgccaaacc ccaggcggag caggagctag cggaactcaa agcgtttgct       960
     gccgagcaag gcgtggggga tttgaatcca tgggatattg gtttttggag tgagcgttta      1020
     cgcgaagccc gctacgatat ttcagaagaa gagttgcgcc cctggtttcc ggcagacacg      1080
     gtaatcaatg gcatgttttc ggtggtcggc aagctgttcg gcattcagtt taaacaacgc      1140
     aaagacgtgg acacttggca cgaggatgtg cgcttctacg agttggtgga tgacgatgga      1200
     ggtgtccgtg cggcgttcta tctggatatg tatgcccgta ctggcaagcg tgggggggct      1260
     tggatggatg atgctcgcat ccgtcgtcgt cagcctgatg gcagcgtgca gaccccggtg      1320
     gcttacctga cctgtaattt cgccccgccg gctggtggta agccgggttt gttgacccac      1380
     gacgaagtcg tgaccctgtt ccatgaattc ggccacggtt tacaccacat gctcaccgag      1440
     caagatgtgt ccggtatttc cgggattaat ggtgtggcgt gggatgcggt ggagctgcct      1500
     agccagtttt tggaaaactg gtgctggacc gaggaaggca ttgctctgat ttccggtcat      1560
     tatcaaactg gcgagccgtt accgaaggaa aagctggaaa aaatgcttgc cgcaaaaaac      1620
     tttcagggtg ccatgcagat ggtgaggcag attgaatttt ctctatttga catgcgcatc      1680
     catgctgaat accagccggg gctgaatatt tatcagatat tggatgaggt gcgcgaacaa      1740
     gtagcagtga ttcggccgcc ctcatttaac cgtttcccca atagcttcgg gcatattttc      1800
     gccggtggtt atgccgcagg ttattacagt tacaaatggg cagaagtgtt atcggcggat      1860
     gcctattctc gctttgaaga agagggcgag ttcaacgaag aaaccggacg ggcatttcgt      1920
     acggaaattc ttgccaaagg cggtagccgc gaacccatgg agcttttcaa ggcgttccgt      1980
     ggtcgtgaac cgagcgtaga accgttgcta cgtcattgcg ggattaatgg ataa            2034
//

If you have problems or comments...

PBIL Back to PBIL home page