(data stored in ACNUC7421 zone)

EMBL: AM286690.PSSA

AM286690.PSSA        Location/Qualifiers
FT   CDS_pept        529590..530414
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="ABO_0486"
FT                   /product="CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase"
FT                   /function="catalyzes the formation of unsaturated
FT                   archaetidylserine from CDP-unsaturated archaeol and
FT                   L-serine"
FT                   /EC_number="2.7.8.8"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF03653"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15934"
FT                   /db_xref="GOA:Q0VSB4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSB4"
FT                   /inference="protein motif:HMMPFAM:HMMPF03653"
FT                   /protein_id="CAL15934.1"
FT                   /translation="MGVLRYTSAIINGWITMQDNDKTAATDTQDTFEVVEAEYRTGTRH
FT                   KGVYLLPNLFTTAALFAGFYAIVAAMNGHFENAALGIIIAGILDGMDGGVARMTNTQSK
FT                   FGAEYDSLSDCVAFGVAPGLVAYAWALSGLGKFGWVAAFIYVACAALRLARFNVQAEST
FT                   DKRFFIGLPSPTGAGLVATLVWLGASRGIEGADISWLVAIVVGGAGLLMVSSVKYHSFK
FT                   EFHIGRVPFKMLLGVIIAFAIVFLDPPLVLLGVAVTYVAAGLLMTLWQLRKH"
     ttgggagtac tgcgttacac tagcgccatc ataaatgggt ggataaccat gcaggataac        60
     gacaagacag cagcgacgga cactcaagac acatttgaag tggttgaagc tgagtatcga       120
     acagggactc gccacaaggg cgtgtaccta ctgcccaatc tgtttaccac agcggccttg       180
     ttcgccggct tctacgccat tgtggctgcg atgaatgggc atttcgaaaa tgccgctttg       240
     gggatcatca ttgccggtat ccttgacggg atggatggcg gtgtggcgag aatgaccaac       300
     acccaaagta agttcggagc ggagtatgac tcgctgtcag actgcgtggc ttttggcgtg       360
     gctccgggac tggtggctta tgcttgggcg ctatcagggc tgggtaagtt tggttgggtg       420
     gcggccttta tctatgtggc ctgcgctgct ttgcgcctag ctcggttcaa tgtacaggcg       480
     gaaagcacgg ataaacgctt ttttatcggt ttgcctagcc ctaccggagc ggggttggtg       540
     gcgacgcttg tctggctggg agctagtcgt ggcattgagg gggcggatat ttcctggcta       600
     gtggccattg tggttggggg tgccggtttg ctgatggtgt cgtcagtgaa gtaccactct       660
     tttaaagaat tccatattgg cagagtcccc ttcaagatgc ttcttggggt gattattgct       720
     tttgccattg tctttttgga ccccccgtta gtgttgttgg gggtagcagt gacctatgtg       780
     gccgcgggtt tactgatgac actttggcag ctgcgtaaac attag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page