(data stored in ACNUC7421 zone)

EMBL: AM286690.PTH

AM286690.PTH         Location/Qualifiers
FT   CDS_pept        complement(567732..568319)
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="ABO_0516"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /function="n-substituted aminoacyl-tRNA + H(2)O =
FT                   n-substituted amino acid + tRNA"
FT                   /EC_number="3.1.1.29"
FT                   /note="(peptidyl-tRNA hydrolase) identified by
FT                   sequencesimilarity; putative InterPro: Peptidyl-tRNA
FT                   hydrolase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15964"
FT                   /db_xref="GOA:Q0VS84"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS84"
FT                   /protein_id="CAL15964.1"
FT                   /translation="MADPVRLIVGLGNPGREYEDTRHNAGVWYVDALARRQGVFLTEDK
FT                   KYFGLTATFSFEGETIRLLVPTTFMNRSGQATAALANFFKIPVTQILVAHDELDLPPGC
FT                   ARFKQGGGHGGHNGLRDIISRHGNSRDFYRLRLGIGHPGSADRVTPHVLSKPSKADRDL
FT                   IDRAIDEAVHNTADMLRGDLNSAMNRLNGFKA"
     gtggcggatc ccgttcgact gatcgtaggc ctgggcaacc cgggccgcga atacgaagac        60
     acccgccaca atgctggcgt ctggtatgtg gacgccctgg cccgacgtca gggcgtcttc       120
     cttaccgaag acaagaaata tttcggcctc accgccacct tttcctttga aggcgaaaca       180
     atccgcctcc tggtaccgac caccttcatg aaccgcagtg gtcaggccac cgccgctctg       240
     gcgaatttct tcaagatccc cgttacgcag atactggttg ctcacgacga gctcgacctg       300
     ccccccggct gcgcccgctt caagcaaggc ggcggccacg gcggccacaa cggtctgcgt       360
     gatattatta gccggcatgg caacagccgt gatttttacc gcctgcgtct aggcatcggc       420
     caccccggct ctgctgaccg ggttacgccc catgtgctga gcaaaccctc caaagccgac       480
     cgagacctga tcgatcgcgc catcgatgaa gctgtccaca acaccgccga tatgcttcgc       540
     ggcgacctga atagcgccat gaaccgactc aacggcttca aggcataa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page