(data stored in ACNUC7421 zone)

EMBL: AM286690.PURE

AM286690.PURE        Location/Qualifiers
FT   CDS_pept        180933..181424
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="ABO_0171"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /function="Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /EC_number="4.1.1.21"
FT                   /note="(phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit) identified by match to PFAM protein family
FT                   HMMPF00731 InterPro:
FT                   1-(5-Phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15619"
FT                   /db_xref="GOA:Q0VTA1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTA1"
FT                   /inference="protein motif:HMMPFAM:HMMPF00731"
FT                   /protein_id="CAL15619.1"
FT                   /translation="MSTPVAVVMGSQSDWETMKEACDALTHFNVGWKAEVVSAHRTPQR
FT                   MYDFAKSAHENGYKVIIAGAGGAAHLPGMIASLTPLPVLGVPVKSRTLSGWDSLLSIVQ
FT                   MPKGVAVGTLAIGAAGAWNAGLLASQMLATENPALLQAIADWKATRADEVLANAELGQG
FT                   "
     atgagcacgc cggttgccgt ggtaatgggc tcccaatctg actgggaaac catgaaagaa        60
     gcctgtgacg ccctgaccca tttcaatgtg ggctggaaag ccgaggtggt ttcggcccat       120
     cgcacgcccc agcgcatgta tgattttgcc aaaagcgccc atgaaaatgg ctacaaggtg       180
     atcattgccg gtgccggcgg tgcggcccat ttgcccggta tgattgcgtc tttgaccccg       240
     ctgccggtgc tgggtgtgcc ggtgaaaagc cgcacgctat ccggttggga tagcctgctg       300
     tctatcgtgc aaatgcccaa aggcgtggcg gtgggtacgt tggccattgg cgcggcgggg       360
     gcctggaatg cgggcctgtt agcttcgcag atgctggcga cggaaaatcc ggcgttgttg       420
     caggcgattg ccgactggaa agccacccgt gcggatgaag tgttggccaa tgccgagctg       480
     gggcagggtt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page