(data stored in ACNUC7421 zone)

EMBL: AM286690.PYRB

AM286690.PYRB        Location/Qualifiers
FT   CDS_pept        complement(36823..37836)
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="ABO_0035"
FT                   /function="Aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15483"
FT                   /db_xref="GOA:Q0VTM5"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTM5"
FT                   /protein_id="CAL15483.1"
FT                   /translation="MTPTLAPSSRVQLTDSGKLRHFLTTEHLPRSLLEDILDTAASFVD
FT                   VGGRAIKKVPLLRGKTVVNLFFESSTRTRSTFELAAQRLSADVLNLDIAKSATSKGETL
FT                   LDTLRNLEAMAADMFVVRHQDSGAPFFIANEVTPNVAVINAGDGRHAHPTQAMLDMYTI
FT                   RHYKGGFEGLKVAIVGDILHSRVARSQVHALNILGADEVRLIGPKTLLPVDAEALGATV
FT                   FTDMAQGLKDVDVVIMLRLQKERMDSALLPSEAEFFRLYGLNNDKLLFAKEDAIVMHPG
FT                   PINRGVEIASEVADGPRSVILNQVTFGIAVRMAVMSMAISGQDSDMSAAGGAHGQR"
     atgacgccga cgcttgcgcc atcctcccga gtacaactta ccgacagcgg taagctccgc        60
     cattttctca ccactgagca tctgccccgc tccctgctgg aagatattct cgatacggct       120
     gcaagctttg tggatgtggg cggccgggca atcaagaagg tcccactgtt acgcggcaaa       180
     accgtggtga acctgttctt cgaatccagt acccgcaccc gcagcacctt tgagctggcg       240
     gcccagcggc tgagcgcgga tgtgctcaat ctggacattg ccaaatcagc gaccagcaag       300
     ggcgaaaccc tgctcgatac cctgcgtaat ttggaagcca tggcggcgga catgttcgta       360
     gtgcgccatc aggattccgg agcgcctttc ttcatcgcca atgaagtaac ccccaacgta       420
     gcggtgatca atgccggtga cggacgccat gcgcacccca ctcaggcgat gctcgacatg       480
     tataccattc gccactacaa gggcggcttc gagggcctga aagtggccat cgttggtgac       540
     attctccatt cccgtgtggc ccgctcccag gtccatgcat tgaatattct tggcgccgat       600
     gaagtacgcc tgatcggccc gaagacatta cttccggtag atgcagaagc cctcggcgca       660
     accgtgttca ccgacatggc tcagggccta aaagacgtgg atgtggtaat catgctgcgt       720
     ctgcaaaaag agcgtatgga ttccgccttg ctgcccagtg aagctgagtt ttttcggctc       780
     tacgggctta acaacgacaa gctgctattt gctaaagagg acgccatcgt gatgcacccc       840
     gggcctatta accggggcgt ggaaatcgcg tcggaagtgg cggatggccc tcgatcagtg       900
     attctcaacc aagtgacgtt cggcatcgcc gtgcgtatgg cggtcatgtc catggccatc       960
     agtggtcagg atagcgacat gtccgcagcg ggaggtgccc atggccagcg ctaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page