(data stored in ACNUC7421 zone)

EMBL: AM286690.RBN

AM286690.RBN         Location/Qualifiers
FT   CDS_pept        complement(297795..298724)
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="ABO_0273"
FT                   /product="ribonuclease BN family protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF03631 InterPro: Putative Ribonuclease BN"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15721"
FT                   /db_xref="GOA:Q0VSX7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSX7"
FT                   /inference="protein motif:HMMPFAM:HMMPF03631"
FT                   /protein_id="CAL15721.1"
FT                   /translation="MDDSSPMKDSFLYWFSILKRSVTLWLEGNAVSYAGSLAFFTLFSL
FT                   APVIILAVKVISLVMTSDAAMAEILGQLEATIGPEAANEVRNAIANTQTPRQGLLAGLL
FT                   SLLVMVIGATTVFAQMQRSMNAIWEVMPRPSRNTIAALIKSRLLSLTVVVSLGFVLLVS
FT                   LLLNVVVQAIIVYAEGWLPIHSSVVVIFEMTVSLVVIGLLFGTMFRVLPDVVLNWKAVM
FT                   PAALITAILFSVGRALIGLYLAHTATASTYGAAGSLVVLLMWVYFSSMILLFGAAFTRA
FT                   HCEARSMEIVARSSAIRVKRQQIDLPAQ"
     atggacgata gtagcccgat gaaagactct ttcctgtatt ggttcagtat tctcaaacgc        60
     agtgtaaccc tgtggctgga gggtaacgcc gtaagctatg ccggctcatt ggctttcttt       120
     accctgtttt ctctcgcccc agtaatcatt ctggcggtaa aagtcatctc cttggtgatg       180
     accagcgatg ccgcaatggc agaaattctc ggtcaattgg aagccaccat tggcccggaa       240
     gcggccaacg aagtgcgcaa cgccatcgcc aacactcaaa cgccccgcca aggtttgctc       300
     gccggcttgc tcagcttact agtaatggtc attggtgcca ccacagtctt tgcccagatg       360
     cagcgctcca tgaatgccat ctgggaggta atgccgcgac cgtcacgcaa caccattgcg       420
     gccttgatca aaagtcggct tttgtctctc accgtggtcg tttctctggg ttttgtactg       480
     ctggtttcgc tccttctgaa cgtagtggtg caggcgatca tcgtctacgc ggagggctgg       540
     ctaccgattc atagtagtgt ggtggtgatc tttgaaatga cggtttcact tgtggtcatc       600
     ggtctgctgt ttggcaccat gttcagagta ctgcccgatg tagtgctaaa ttggaaagca       660
     gtaatgccag cggccctgat caccgccatt ctgttttctg tgggccgcgc gctaatcggc       720
     ttgtacctag cccataccgc cacggcgtct acttacggcg ctgccggctc tctggtggta       780
     ctgctgatgt gggtatattt ctcctccatg atcctgctgt tcggggccgc tttcacccgc       840
     gcccattgcg aggcacggag catggaaatc gtagcgcgaa gcagcgctat tcgggtaaaa       900
     cgtcagcaga ttgatctacc cgcccaataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page