(data stored in ACNUC7421 zone)

EMBL: AM286690.RIBF

AM286690.RIBF        Location/Qualifiers
FT   CDS_pept        497855..498832
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ABO_0458"
FT                   /product="FAD pyrophosphorylase"
FT                   /function="atp + riboflavin = adp + fmn / atp + fmn =
FT                   diphosphate + fad"
FT                   /EC_number="2.7.7.2"
FT                   /note="(riboflavin biosynthesis protein RibF) identified by
FT                   sequence similarity; putative InterPro: Riboflavin kinase /
FT                   FAD synthetase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15906"
FT                   /db_xref="GOA:Q0VSE2"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSE2"
FT                   /protein_id="CAL15906.1"
FT                   /translation="MRLIRGIHNLRDTHRGCVATIGNFDGVHQGHQRILDQVIAEARGR
FT                   GLKATVMLFEPQPQEFFSPQTAPPRLMSLRDKLIALREAGVDQVLCLRFDERFRSLTAQ
FT                   AFVKGLLVDGLGVEYLVVGDDFRFGCGRDGDFSYLQQAGKQFDFAVTDTATCEIEGDRV
FT                   SSTRVRAALREGDFALAERLLGRPFAISGRVRHGDKIGRTLGLPTVNLALKRLQSPLHG
FT                   VFAVAVTGAGLTDQPGAANMGTRPTVNGTENRLEVYLLDYGDPAGSSGDAQCSHQDSLY
FT                   GAHLTVAFRHYVRPEEKFADLDLLKTAIRQDINAVRAFFDMPTV"
     atgcgactga ttcgcggcat tcacaatctg cgcgatacgc atcgcggctg tgtggctacc        60
     atcggcaatt tcgatggggt gcatcagggc catcagcgca ttctggatca ggttatcgca       120
     gaggcccgtg gccgtggcct gaaagccacc gtgatgttat tcgagccgca accccaggag       180
     tttttttccc cccagacagc gccgccgcgg ctgatgtcgc tgcgcgacaa gttgatcgcc       240
     ctgcgcgagg ccggtgtgga tcaggtgctg tgtctgcgct ttgatgagcg ttttcgctct       300
     ctgacggcgc aagcctttgt gaagggctta ttagtagatg gtttgggggt ggagtatctg       360
     gtggtggggg atgattttcg ttttggttgt ggccgagatg gtgatttttc ctatttgcag       420
     caggccggaa aacagtttga ttttgcggtg accgataccg ccacctgtga aattgaaggt       480
     gatcgggtgt ccagcacccg ggtgcgagca gcgctaaggg agggtgactt cgcgttagcg       540
     gagcgcttgc tggggcgacc ttttgctatt agtggccggg tacgccatgg cgacaaaatt       600
     ggccggacct tggggctgcc cacggtgaat ctggcgttaa aacgtttaca gtcccccttg       660
     catggtgttt ttgcggtggc ggttactggc gcagggctta ccgaccagcc cggggccgcc       720
     aatatgggca cccgtcccac ggtgaatggc acggagaatc gtttggaagt atatctgctg       780
     gattacggtg atccggcggg tagctcaggc gatgctcagt gctcgcatca agatagcctg       840
     tacggcgcgc acctgacagt ggccttccgc cattatgtgc gcccggaaga aaaattcgcg       900
     gatctggact tgttgaaaac tgccatccgg caggacataa acgcggtccg ggcctttttt       960
     gatatgccta cggtgtaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page