(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLF

AM286690.RPLF        Location/Qualifiers
FT   CDS_pept        455564..456097
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="ABO_0412"
FT                   /product="50S ribosomal protein L6"
FT                   /function="This protein binds directly to 23S ribosomal RNA
FT                   and is located at the aminoacyl-tRNA binding site of the
FT                   peptidyltransferase center."
FT                   /note="(ribosomal protein L6) identified by
FT                   sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15860"
FT                   /db_xref="GOA:Q0VSI8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSI8"
FT                   /protein_id="CAL15860.1"
FT                   /translation="MSRVAKSPVNLPKGVEVKIDGQKVAVKGGKGSLEHEVHELVAVSL
FT                   EDGVVSVKPHDDSQKGWALAGTTRALLNNMVTGVADGFERKLQLLGVGYRAQAQGKVLN
FT                   LTLGFSHPVAYQLPEGITVETPSQTEIVIKGIDKQLVGQVAANVRAFRPPEPYKGKGVR
FT                   YADEQVRRKEAKKK"
     atgtctagag tagcaaaaag tccggtaaat ctgcctaaag gcgtcgaggt taaaatcgat        60
     ggccaaaaag tcgctgtaaa aggtggcaaa ggcagcctgg agcatgaagt tcacgagctg       120
     gtagcagtgt ccttggaaga tggcgtggtg tcggttaaac cccacgacga ctctcagaag       180
     ggctgggcgt tagctggaac cacgcgtgct ctgctgaata acatggtaac cggcgttgcc       240
     gatgggtttg agcgtaagct tcaactcttg ggtgttggtt accgcgcgca ggctcagggc       300
     aaggttctta acctgaccct cggtttctcc catccggtgg cttaccaatt gccagaaggg       360
     attaccgttg aaactccgag ccagacagaa attgtcatta aaggcattga taagcaactg       420
     gtaggtcaag ttgctgccaa tgttcgggcc ttccgtccgc ctgagcctta caagggcaaa       480
     ggggtgcgct atgctgatga gcaagtgcgc cgtaaggaag ccaagaagaa ataa             534
//

If you have problems or comments...

PBIL Back to PBIL home page