(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLQ

AM286690.RPLQ        Location/Qualifiers
FT   CDS_pept        461784..462167
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="ABO_0423"
FT                   /product="50S ribosomal protein L17"
FT                   /function="Ribosomal protein L17"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF01196 InterPro: Ribosomal protein L17"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15871"
FT                   /db_xref="GOA:Q0VSH7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSH7"
FT                   /inference="protein motif:HMMPFAM:HMMPF01196"
FT                   /protein_id="CAL15871.1"
FT                   /translation="MRHRKSGRKLNRNSSHRQAMFRNMAVSLLEHEAIKTTLPKAKELR
FT                   RVAEPLITLAKEDSVANRRLAFDRTRSKEMVGKLFNELGPRYQERPGGYIRILKMGFRA
FT                   GDNAPMAYVELVDRPELVDADEE"
     atgcgtcatc gcaaaagcgg cagaaaactg aaccggaaca gctctcatcg tcaggcgatg        60
     ttccgtaaca tggctgtgtc tctgctggag cacgaagcga tcaagaccac tttgccgaag       120
     gctaaagagc tccgtcgtgt ggctgagccg ctgatcactt tggccaagga agactcagtt       180
     gcaaaccgtc gtttagcttt cgaccgtacc cgttctaagg aaatggttgg taagcttttc       240
     aacgaactgg ggcctcgtta ccaagagcgt ccgggtggct acatccgcat tcttaagatg       300
     ggtttccgtg cgggcgataa cgcaccgatg gcctatgttg agcttgttga ccgtcctgaa       360
     ctggttgacg ctgacgaaga gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page