(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLV

AM286690.RPLV        Location/Qualifiers
FT   CDS_pept        451562..451906
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="ABO_0402"
FT                   /product="50S ribosomal protein L22"
FT                   /function="This protein binds specifically to 23S rRNA; its
FT                   binding is stimulated by other ribosomal proteins, e.g.,
FT                   L4, L17, and L20. It is important during the early stages
FT                   of 50S reconstitution."
FT                   /note="(ribosomal protein L22) identified by match to PFAM
FT                   protein family HMMPF00237"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15850"
FT                   /db_xref="GOA:Q0VSJ8"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSJ8"
FT                   /inference="protein motif:HMMPFAM:HMMPF00237"
FT                   /protein_id="CAL15850.1"
FT                   /translation="MATEVAARLRGARISAQKARLVADQVRGLEVEKALNLLEFSPKKA
FT                   AKIVKKVLESAIANAENNDGADVDELKVSTVFVDEGMTMKRIRPRAKGRADRILKRTCH
FT                   ITVKVSEGQE"
     atggctactg aagttgcagc ccgtctgcgc ggtgcaagaa tttcggctca gaaagcccgc        60
     ctcgtagctg accaggtccg tggcctggag gttgagaagg cgctgaatct tctggaattc       120
     agcccgaaga aggcggcaaa aatcgttaag aaagtgctgg agtccgcgat tgcaaatgcg       180
     gaaaacaacg acggcgctga cgtagatgag ctgaaggtgt ccacggtatt cgtggatgaa       240
     ggtatgacga tgaaacggat tcgtccgcgg gccaaaggcc gtgcagaccg tatcctaaag       300
     cgtacttgcc acattactgt gaaagtctca gaaggtcagg agtaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page