(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLY

AM286690.RPLY        Location/Qualifiers
FT   CDS_pept        complement(568328..568972)
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="ABO_0517"
FT                   /product="50S ribosomal protein L25"
FT                   /function="Binds to the 5S rRNA"
FT                   /note="(ribosomal 5S rRNA E-loop binding
FT                   proteinCtc/L25/TL5) identified by match to PFAM protein
FT                   family HMMPF01386 InterPro: Ribosomal protein L25"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15965"
FT                   /db_xref="GOA:Q0VS83"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS83"
FT                   /inference="protein motif:HMMPFAM:HMMPF01386"
FT                   /protein_id="CAL15965.1"
FT                   /translation="MSNEFLLNAESRSDTGKGASRRLRRLQERVPGILYGGEAEPQMIS
FT                   VELRELKKALENEAFYSHILTLKLDGADVQAVLRDMQRHPAKGHPLHVDLLRVDKTHKI
FT                   TMSVPLHFTNEESSIGVKKQGGEIQHNFAEVEVSCLPQHLPEFIEVDMANAELDSVVHL
FT                   SDLKLPKGVELTQLALGEDHDQPVAAVHQPKVRASSDDDDAAEGEEAASEE"
     atgtccaatg aattcctgct gaatgcagaa agccgcagcg atacagggaa aggtgcgagc        60
     cgccgcctgc gtcgtctgca agaacgtgtt cctggcatcc tctacggtgg cgaagccgag       120
     ccgcagatga tcagcgttga actgcgcgag ctgaaaaaag ccctggaaaa cgaagcgttc       180
     tacagccaca tcctcaccct caagctagac ggtgctgatg ttcaagccgt actgcgtgac       240
     atgcagcgtc atccggccaa aggccacccg ctgcacgtgg atctgctgcg cgtcgacaag       300
     acccacaaga tcaccatgag cgttcccttg cacttcacca acgaagaaag ctccatcggc       360
     gtgaaaaagc aaggcggcga gatccagcac aacttcgcag aagtagaagt gagctgtctg       420
     ccccagcacc tgcctgagtt catcgaggtg gacatggcta acgctgagct agactccgtt       480
     gttcacttgt ccgatttgaa actgccgaaa ggcgtggaac tgacccagct cgcactgggc       540
     gaagaccacg accagccggt ggccgcggtt caccaaccca aagtgcgtgc gtcttccgat       600
     gatgacgacg cagcagaagg cgaagaagcc gcaagcgagg aataa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page