(data stored in ACNUC7421 zone)

EMBL: AM286690.RPMC

AM286690.RPMC        Location/Qualifiers
FT   CDS_pept        453034..453225
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="ABO_0405"
FT                   /product="50S ribosomal protein L29"
FT                   /function="Ribosomal protein L29"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Ribosomal protein L29"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15853"
FT                   /db_xref="GOA:Q0VSJ5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSJ5"
FT                   /protein_id="CAL15853.1"
FT                   /translation="MKASELKEKSVEELQQTQIELLEEQFKLRMKSASGQISKTHELGT
FT                   VRRNIARVKTILREKQGN"
     atgaaagcga gcgagctgaa agaaaagagt gtcgaggagc tgcagcagac gcaaatcgag        60
     ctgcttgagg aacaattcaa gctgcgtatg aagagcgcgt ccggtcagat ttctaaaacc       120
     catgagcttg ggacggttcg ccgcaatatt gcgcgcgtaa agaccattct gagagagaaa       180
     cagggtaact ag                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page