(data stored in ACNUC7421 zone)

EMBL: AM286690.RPOB

AM286690.RPOB        Location/Qualifiers
FT   CDS_pept        418985..423127
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="ABO_0378"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /function="DNA-directed RNA polymerase beta subunit/140 kD
FT                   subunit (split gene in Mjan, Mthe, Aful)"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: RNA polymerases beta subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15826"
FT                   /db_xref="GOA:Q0VSM2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSM2"
FT                   /protein_id="CAL15826.1"
FT                   /translation="MAYSFTEKKRIRKDFGKLPKVMEVPYLLAIQLDSYRKFLQQDKSA
FT                   EERLEEGLEAAFRSVFPIASYSGNAALEYAGYEFGKPVFDVKECIIRGTTYAAPLRVRI
FT                   RLVIYDRESSGAIKDIREQQVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDHD
FT                   KGKTHSSGKLLYSARVIPYRGSWLDFEFDPKDQVFVRIDRRRKLPATILLRALGYTSDE
FT                   VLEMFFDTNEIAVEDGIYRMKLVPERLRGETATFDILADGEVVVERGRRITARHIRQLE
FT                   KANIEYLDIPAEYLQGKYLAKSIIDQDTGEILVECNTELTAETLEKLEQGGITDFETLY
FT                   TNDLDNGPFMADTLRADPTRTPLEALVEIYRMMRPGEPPTKEAAENLFKNLFFTDERYD
FT                   LSTVGRMKFNRRLGREDETGPGILYDGRYFSARSDEEGKQYFEQMGGETSDIIDVLRTL
FT                   VDIRNGNGVVDDIDHLGNRRVRSVGEMAENQFRVGLVRVERAVKERLSLAESEGLMPQD
FT                   LINSKPVAAAVKEFFGSSQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDV
FT                   HPTHYGRVCPIETPEGPNIGLINSLATYARANEYGFLESPYLKVIDGKVSEEIEYLSAI
FT                   EEAECVIAQVDAKMTEEGGFEEDFVTVRHRYEFTVMERDTITHMDVSPRQVVSVAASLI
FT                   PFLEHDDANRALMGSNMQRQAVPTLRADKPLVGTGFERHVARDSGVCVVATRGGIVDKV
FT                   DASRIIVKVNDDEVSEGEAGVDIYNLTKYTRSNQNTCINQRPLVKVGDRVAARDIMADG
FT                   PSVDMGELALGQNMRVAFMPWNGYNFEDSILISEKVVKDDRFTSIHIQELTCIARDTKL
FT                   GPEEITADIPNVGEAALSKLDESGIVYIGAEVEAGDILVGKVTPKGETQLTPEEKLLRA
FT                   IFGEKASDVKDTSQRVSSGVKGTIIDVQVFTRDGVEKDERARQIEQAALEQFRKDLKDE
FT                   YRILELDILERLRAVMVGKKVNGGAGFKRGTEMTGEILDGLDAEKWFELRPADDDVAEQ
FT                   LERAQQYLEQHKKEQDERYKDKQAKISGGDDLAHGVLKVVKVYLAIKRRIQPGDKMAGR
FT                   HGNKGVISVIMPEEDMPHDENGVPVDVVLNPLGVPSRMNVGQILETHLGWAAKGLGERI
FT                   GEMLAEQKKIADIRVFLDKIYNQAGAGGTPEDLDSFSDDEIIELAKNLVGGVPMATAVF
FT                   DGAKEFEIKELLELAGHDRSGQVQLWDGRTGEAFDRKVTVGYMYMLKLNHLVDDKMHAR
FT                   STGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTRVY
FT                   KNIVDGDHRMDPGMPESFNVLLKEIRSLGINIELEND"
     atggcatact cattcactga gaaaaagcgg atccgcaaag atttcggcaa gcttccgaaa        60
     gttatggagg tgccttatct cctggcgata caactcgatt cttaccgcaa attcctgcag       120
     caagataaga gcgctgaaga gcgcctggaa gaaggtctgg aagccgcttt ccggtcggta       180
     tttccgatcg caagttattc aggaaatgca gcgctggagt atgccggcta cgagttcggc       240
     aaacccgttt ttgatgtaaa agaatgcatc attcgcggta ctacctatgc ggcgccattg       300
     cgcgtgcgta ttcgtctggt gatttacgat cgtgaatcat ccggggcgat taaagatatt       360
     cgtgaacaac aggtctacat gggtgagatt cccttaatga ccgaaaacgg taccttcgtt       420
     attaatggta ccgaacgtgt gattgtgtct cagttgcacc gctcgcctgg tgttttcttt       480
     gaccacgata aaggtaaaac tcactcttcc ggtaagctgc tctattctgc ccgggtgatt       540
     ccttaccgtg gttcctggtt ggatttcgag ttcgatccta aagaccaagt ctttgtacgg       600
     atcgaccgtc gccgcaagtt gccggcgacc atcctactgc gtgcgttggg gtatacctct       660
     gacgaagtgt tggagatgtt tttcgacacc aacgaaatcg cagtggaaga cggcatttac       720
     cgcatgaagc tggtgccgga gcgtctgcgt ggtgaaaccg cgaccttcga catccttgcc       780
     gatggtgaag tcgtggtgga gcgtggccgt cgtattactg cacgtcacat tcgtcagttg       840
     gaaaaagcca acatcgaata tctggacatc ccggccgagt acttgcaggg caagtatctg       900
     gctaagtcga tcatcgatca ggataccggt gaaattctgg tggagtgtaa taccgagctg       960
     accgcggaga cgctggaaaa gcttgagcaa ggtggtatta ccgactttga aacactttat      1020
     acaaacgacc tggataacgg gccgttcatg gcggacaccc tgcgggccga tccgactcgt      1080
     acgccgctgg aggcattagt cgagatttac cggatgatgc gtccaggcga gccgccgacg      1140
     aaagaggccg ccgaaaacct gttcaaaaac ttgttcttca ctgatgagcg gtatgacctg      1200
     tccaccgttg gccggatgaa gttcaaccgc cgccttggtc gtgaagatga aacgggtcct      1260
     ggcattctct atgacggtcg ctactttagt gcgcgctctg atgaagaagg caagcagtac      1320
     ttcgagcaga tgggggggga aacctccgac atcattgatg tactgagaac cttggtggat      1380
     atccgtaacg gtaacggggt ggtggatgat atcgaccacc taggtaaccg tcgcgtacgt      1440
     tctgtgggtg agatggccga aaaccagttc cgtgttgggt tggtgcgtgt tgaacgtgcg      1500
     gtcaaagagc gtcttagtct ggctgaatcc gaaggcttga tgccgcagga tctgatcaat      1560
     tccaagccgg tggcagccgc agtgaaagag ttctttggct cttcccagct gtctcagttt      1620
     atggatcaga acaacccgct gtccgagatc acccacaagc gtcgtgtttc tgcgttgggc      1680
     ccgggcgggc tgacccgtga gcgtgctggt tttgaggtgc gtgacgtgca cccgactcac      1740
     tatggtcgtg tatgtcctat cgaaacacct gaaggcccga atattggtct gatcaactct      1800
     ctggctacct atgcccgcgc caacgagtac ggtttccttg agtctccgta cttgaaggtg      1860
     attgacggca aggtcagtga ggaaatcgaa tacctgtcag cgatcgaaga ggccgagtgc      1920
     gtgatcgcac aggtggacgc gaagatgaca gaagagggcg gtttcgaaga agacttcgtt      1980
     actgtacgtc accgttacga atttaccgtg atggagcggg acaccattac ccatatggat      2040
     gtctcccctc gtcaggtggt atccgtggcg gcgtccctga ttccgttcct cgagcatgat      2100
     gatgcgaacc gggccttgat ggggtcgaac atgcagcgtc aggctgtgcc taccctgcgt      2160
     gctgacaagc cactggtagg tacgggcttc gagcgtcacg ttgcccgtga ctccggtgtc      2220
     tgtgtggttg ctacccgtgg cggtatcgtc gacaaggttg atgcatcgcg aatcattgtg      2280
     aaggttaatg atgacgaagt gagcgaaggt gaagcaggtg tagatatcta caacctgact      2340
     aaatacaccc gctccaacca gaacacctgc atcaatcagc gtccgctggt gaaagtgggt      2400
     gaccgggttg ctgcacgcga catcatggct gacggtcctt ctgtggacat gggcgagctg      2460
     gccctgggcc agaacatgcg cgtggccttc atgccatgga atggttacaa ctttgaggat      2520
     tccatcctca tctctgagaa agtggtgaag gatgatcgat tcacctccat ccacattcag      2580
     gaactcactt gtattgctcg tgataccaag ctgggtccgg aagagattac cgctgatatc      2640
     cccaatgtgg gtgaggccgc gctatccaag ctggatgagt ccggtattgt ctacatcggt      2700
     gcagaagtgg aagccggtga cattctggtg ggcaaggtaa cgccgaaagg tgaaactcag      2760
     ctgaccccgg aagaaaaact gttgcgtgcc atctttggcg agaaggcctc cgacgttaaa      2820
     gatacctctc agcgcgtatc ttccggcgtt aaaggcacca tcatcgatgt gcaggtcttt      2880
     acccgcgacg gtgttgagaa agatgagcgt gcccgtcaaa ttgagcaggc tgcccttgag      2940
     cagttccgca aagatttgaa agacgagtac cgcattctcg agctggatat tctggaacgt      3000
     ctgcgtgccg tcatggtagg caagaaggtc aatggtggtg cgggcttcaa gcgcggcact      3060
     gagatgaccg gcgagatcct ggatggtctg gatgccgaga aatggttcga actgcgccca      3120
     gctgatgatg atgtcgctga gcaacttgag cgtgctcagc agtatctgga gcagcacaaa      3180
     aaagagcagg acgaacgcta caaggataaa caggccaaga tctccggcgg tgatgacctc      3240
     gcccatggtg tgctgaaagt ggttaaggtc tacctggcca ttaagcgtcg catccagccc      3300
     ggtgacaaga tggctggccg tcacggtaac aagggtgtga tttctgtaat catgcctgaa      3360
     gaagatatgc cgcatgatga gaacggcgtg ccggtggatg tggtcttgaa cccgctgggt      3420
     gtaccgtccc gtatgaacgt ggggcagatt ctggaaaccc acttaggctg ggctgccaag      3480
     ggtcttggtg agcggatcgg cgaaatgctg gccgagcaga agaagattgc agacattcgc      3540
     gtcttcctcg acaagatcta taaccaggca ggcgccggcg gtaccccaga agatctggat      3600
     agctttagcg atgatgaaat catcgagctg gccaagaact tggtgggcgg tgtgcctatg      3660
     gcaaccgcgg tattcgacgg tgccaaagag ttcgagatca aggagctgct ggagctggct      3720
     gggcacgatc gctccggtca ggtgcagtta tgggatggtc gtaccggtga agcctttgat      3780
     cgcaaggtta ccgtgggcta catgtacatg ctcaagttga accacttggt ggacgacaag      3840
     atgcatgcgc gctccactgg ttcctacagc ctggttaccc agcagccgct gggtggtaag      3900
     gcgcagttcg gtggtcagcg tttcggtgag atggaagtgt gggcgctgga agcctatggc      3960
     gccgcgtaca ccttgcagga aatgctcact gtgaaatccg atgacgtgaa tggccgtacc      4020
     cgcgtttaca agaacatcgt ggacggtgat caccgcatgg atccgggtat gccggaatcc      4080
     ttcaacgtat tgctgaagga aattcgttct ctcggtatca atatcgagct ggaaaacgac      4140
     taa                                                                    4143
//

If you have problems or comments...

PBIL Back to PBIL home page