(data stored in ACNUC7421 zone)

EMBL: AM286690.RPOC

AM286690.RPOC        Location/Qualifiers
FT   CDS_pept        423222..427424
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="ABO_0379"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /function="DNA-directed RNA polymerase beta' subunit/160 kD
FT                   subunit (split gene in archaea and Syn)"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15827"
FT                   /db_xref="GOA:Q0VSM1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSM1"
FT                   /protein_id="CAL15827.1"
FT                   /translation="MKDLLNLLKSQGQVTEFDKIRIALAPPDLIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLSKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVTEPGMTTLERGQLLTDE
FT                   EYFDAMEEFGDEFEAKMGAEAVQQLLMELDLVEEIKILREEVESTNSDTKLKKLSKRLK
FT                   LMEAFKDSGNAPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLSAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHECGLPKKMALELFKPFIFAKLEGRGLATTIKAAKK
FT                   MVERETAEVWDILAEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIGPTQDVVLGLYYISRDR
FT                   VNAQGEGHVFADTKEVMRALGNKQVHIHARVKVRVHEVVKDLEGNVEERTFIADTTPGR
FT                   CKLWDIVPAGLGFDMVNQNMTKKAISKLLNTCYRILGTKETCIFADQLMYLGFREATLS
FT                   GSSIGVEDMVIPDAKYTMIDAAEEEVREIEEQFASGLVTRGERYNKVVDIWARTNDQIA
FT                   KAMMENLRVEVVKNRDGKDEEQGSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITSNFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVNHI
FT                   DCGTEEGLLMTPLIEGGDVVEPLRERVLGRVVARDVMNPLNQDEVAVEAGTLLDEVWVA
FT                   QLETMGVDEVLVRSPITCATRWGVCATCYGRDLARGHQVNVGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRASAVSSIQIKHGGKVRFHNAKHVQHKDGLVIVSRSADLAVADELG
FT                   RERERYKLPYGATVTVNEGDEVSGGQVVATWDPHTHPIIAEVEGKVQFGDMEEGITVNH
FT                   QTDELTGLTNIEMLSSQNRPSAGKDMRPVIRVLDSKGKPIVMPNTDMPAQYFLPGGALC
FT                   GLKDGANIGVGDVIARIPQESSKTRDITGGLPRVADLFEARNPKEAAILAEKTGTVSFG
FT                   KETKGKVRLVITPDNSDDNYEELIPKWRQLNVFEGERVEKGEVVSDGPLNPHDILRLKG
FT                   ESELARYIVNEVQEVYRLQGVKINDKHIETIIRQMLRKVEILEVGESHFIKGEQAEYAR
FT                   VMEEIDRLKAEDKMLPQYQRLLLGITKASLATESFISAASFQETTRVLTEAAVTGKEDD
FT                   LRGLKENVVVGRLIPAGTGYAYHMERRRQRADARGPEAPTMDEVEAALSEALSSSGE"
     ttgaaagact tgctgaattt gctcaaaagt cagggacaag tcacggagtt cgacaagatc        60
     cgcatcgcgc ttgcgccgcc ggatctgatc cgctcctggt cttttggcga agtgaaaaag       120
     cctgagacca ttaactaccg cacgttcaag cctgagcgtg atggtctgtt ttgtgcgcgt       180
     atctttggtc cgatcaaaga ctacgaatgc ctgtgcggta agtacaagcg tttgaagcat       240
     cgtggcgtta tctgtgaaaa gtgtggcgta gaagtcaccc tttccaaggt gcgtcgtgag       300
     cgcatgggcc acatcgaact ggcaagccct actgcacaca tctggttcct gaagtctctg       360
     ccgtcccgta tcggtttgat gctggatatg accctgcgtg atatagagcg ggtcctgtac       420
     ttcgaatctt tcgttgtgac cgagccaggc atgacaacgc ttgagcgtgg gcagctgctt       480
     accgatgaag agtacttcga cgccatggaa gaattcggag acgaattcga agccaagatg       540
     ggtgccgaag ctgtacagca actcctgatg gagttggatc tggtcgaaga gatcaagatc       600
     ctgcgcgagg aagtggagtc cacgaactct gataccaagc tgaagaagct gtccaaacgc       660
     ctcaagctga tggaagcctt caaggattcc ggtaacgcgc ccgaatggat ggttctcacc       720
     gtgctgccgg tactgccgcc ggatctgcgt ccgctggtgc cgctcgatgg tggtcgtttt       780
     gcgacctccg atttgaacga tctgtatcgc cgggtaatca accgtaacaa tcgcctcaag       840
     cggttgctgg atctgagcgc gccggacatc atcgtgcgga acgaaaagcg tatgctgcag       900
     gaatctgtag atgcgttgtt ggacaacggt cgtcgtggcc gtgccattac cggttctaac       960
     aagcgtcctt tgaagtccct tgccgacatg atcaagggta agcagggccg cttccgtcag      1020
     aacctgttgg gtaagcgagt cgattactcc ggtcgttccg tgatcgtggt aggtccgact      1080
     ctcaagctgc acgagtgtgg tctgcccaag aaaatggcgc tggaactgtt caagccgttt      1140
     atctttgcca agctggaagg gcgtggtctg gcgaccacca ttaaggcggc caagaaaatg      1200
     gtcgagcgcg aaaccgctga agtgtgggat atcctcgctg aagttattcg cgaacacccg      1260
     gttatgttga accgggcgcc aacccttcac cgtctcggta ttcaggcgtt tgagccggtg      1320
     ctgattgaag gtaaggccat ccagctgcac ccgctggtgt gtgcggcctt caacgccgac      1380
     ttcgatggtg accagatggc ggtgcacgta ccgctgaccc tggaagcgca gcttgaagcc      1440
     cgtgcattga tgatgtccac caacaacatt ctttcgcccg ccaatggtga gccgattatc      1500
     ggcccaaccc aggacgtggt gctgggtttg tattacatca gccgtgaccg tgtgaatgcg      1560
     caaggtgaag gccatgtatt tgccgacacc aaggaagtga tgcgtgcgct gggtaacaag      1620
     caggtgcaca tccacgcccg cgttaaggtg cgtgtgcatg aagtggtgaa agacctggaa      1680
     ggtaacgtgg aagagcgtac ctttatcgcc gatactaccc ctggtcgttg taagctgtgg      1740
     gatatcgtgc cggcgggtct gggcttcgac atggtcaacc agaacatgac caagaaggcc      1800
     atctccaagc tgttgaacac ctgttaccgg attcttggca ccaaagagac ctgtatcttc      1860
     gctgaccaat tgatgtacct gggcttccgc gaagcaacgc tttctggttc ttccattggt      1920
     gtggaagaca tggtgattcc ggatgccaag tacaccatga tcgacgctgc cgaagaggaa      1980
     gtgcgcgaga tcgaggagca atttgcttcc ggtctggtga ctcgcggtga gcgttacaac      2040
     aaggtcgtgg atatttgggc tcgtaccaat gaccagatcg ctaaggcgat gatggaaaac      2100
     ctccgtgttg aagtggttaa aaaccgcgac ggcaaggacg aagagcaggg ctctttcaac      2160
     tccatcttca tgatggccga ttccggggca cggggttccg ctgctcagat tcgtcagctg      2220
     gccggtatgc gtggtctgat ggcgaagccg gatggctcca ttatcgaaac gcctattacc      2280
     agtaacttcc gtgaaggttt gaacgtactc cagtacttca tctctactca cggtgctcgt      2340
     aaaggtctgg cggataccgc actgaaaaca gcgaactctg gttacttgac tcgtcgtcta      2400
     gtggatgtgg cgcaggatct ggtggtcaac catatcgact gtggcaccga agaaggtttg      2460
     ctgatgacgc cgctgattga aggtggtgac gtggtagagc cgctgcgcga gcgtgtactc      2520
     ggtcgtgtgg ttgcccgtga cgtgatgaat cctctcaacc aggacgaagt agcggttgaa      2580
     gccggcacgt tgctggacga agtttgggtt gcgcagctgg aaaccatggg tgtggacgaa      2640
     gtgctggtgc gctcgccgat tacctgtgcg actcgttggg gcgtgtgtgc gacctgttat      2700
     gggcgtgact tggctcgtgg ccatcaggtc aatgtgggcg aggctgtcgg tgttatcgca      2760
     gcacagtcca ttggtgagcc gggtacccag ctgaccatgc gtaccttcca cattggtggg      2820
     gcggctagcc gagcgtctgc agtatccagc atccagatca aacacggcgg taaggtgcgt      2880
     ttccataacg ccaagcacgt gcagcataag gacggtctgg taatcgtttc ccgttctgct      2940
     gatctggctg ttgctgatga gctgggccgt gaacgtgagc gttataagct gccctacggt      3000
     gccacggtta ccgtgaatga aggtgatgag gttagtggtg gtcaggtcgt tgcgacctgg      3060
     gatccgcaca cacacccgat cattgcggaa gtggagggta aggtgcagtt cggtgatatg      3120
     gaagaaggta tcactgtaaa ccatcagacc gacgagctca ccggcctgac caacattgaa      3180
     atgctcagtt cccagaaccg tccttcagca ggtaaggaca tgcgtccggt tatccgtgtg      3240
     ctggacagca agggcaagcc catcgtgatg cccaatacgg atatgccagc ccagtacttc      3300
     ctgccgggtg gtgcactgtg tggcctgaaa gatggcgcga atatcggcgt tggtgatgtg      3360
     atcgcgcgga ttccgcagga gtcctctaag actcgcgaca tcaccggtgg tctgccccgt      3420
     gttgctgatt tgttcgaagc acggaacccg aaagaagcgg caatcctggc tgaaaagact      3480
     ggtaccgtat ccttcggtaa agaaaccaaa ggtaaggttc gccttgttat cactccggat      3540
     aatagtgatg acaactacga agaattgatt ccgaaatggc gtcagctcaa cgtatttgaa      3600
     ggtgagcggg ttgagaaagg tgaggttgtc tctgatggac cgctgaaccc gcacgacatc      3660
     ctgcgcctta aaggtgagtc tgagctggcc cgttacatcg ttaacgaagt gcaggaggtt      3720
     taccgtctgc agggtgtgaa gatcaatgac aagcacattg aaacgatcat ccgccagatg      3780
     ttgcgcaaag tagagatcct ggaagtgggt gagtctcact tcattaaggg tgagcaggca      3840
     gaatatgccc gcgttatgga ggaaattgat cgcctgaaag ccgaagacaa gatgctgccg      3900
     cagtaccaac gactgctatt aggtatcacc aaggcttccc tggcgacaga gtccttcatc      3960
     tctgcggcgt ctttccagga aaccacccgc gttctcaccg aagcggcggt aaccggcaag      4020
     gaagacgact tgcgtggctt gaaagaaaac gttgttgtgg gtcgtttgat ccccgccggt      4080
     accggctatg cctatcacat ggagcgtcgt cgtcagcgtg cggatgcgcg cgggccagaa      4140
     gcgccaacca tggacgaggt agaagctgcg ctgtcagaag ctcttagctc ctcaggcgag      4200
     taa                                                                    4203
//

If you have problems or comments...

PBIL Back to PBIL home page