(data stored in ACNUC7421 zone)

EMBL: AM286690.RPOZ

AM286690.RPOZ        Location/Qualifiers
FT   CDS_pept        complement(186855..187118)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ABO_0177"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /function="Catalyses DNA-template-directed extension of the
FT                   3'- end of an RNA strand by one nucleotide at a time. Can
FT                   initiate a chain de novo"
FT                   /EC_number="2.7.7.6"
FT                   /note="(DNA-directed RNA polymerase, omega subunit)
FT                   identified by sequence similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15625"
FT                   /db_xref="GOA:Q0VT95"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT95"
FT                   /protein_id="CAL15625.1"
FT                   /translation="MARVTVEDCLEKLDNRFELVLVAGKRAHQLQSGGKEPRVAWENDK
FT                   PTVVALREIAEGLVTAESVDNPIADRSADVDELALLTQSFGE"
     atggcacgag ttaccgtaga agattgcctg gaaaaactgg ataaccgctt tgagctggtg        60
     ctggttgccg gcaagcgcgc ccatcaattg cagagcggcg gtaaagagcc acgtgtagct       120
     tgggaaaacg acaaacccac cgttgtcgcc ctgcgcgaaa tcgcagaagg cctcgtcacc       180
     gctgaatccg tggataaccc catcgcggac cgcagtgccg acgtggacga gctagcgctg       240
     ctgacccagt ctttcggcga gtaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page