(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSH

AM286690.RPSH        Location/Qualifiers
FT   CDS_pept        455140..455532
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="ABO_0411"
FT                   /product="30S ribosomal protein S8"
FT                   /function="One of the primary rRNA binding proteins, it
FT                   binds directly to 16S rRNA central domain where it helps
FT                   coordinate assembly of the platform of the 30S subunit"
FT                   /note="(ribosomal protein S8) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S8"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15859"
FT                   /db_xref="GOA:Q0VSI9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSI9"
FT                   /protein_id="CAL15859.1"
FT                   /translation="MSMQDTLADMFTRIRNAQMAKKVQVEIPASKAKEAVAKVLKDEGY
FT                   IAGYEVTGDKKPVMTVELKYYEGSPVIEKIARVSRPGLRVYKSAGEIPKVKDGLGVMIV
FT                   STNQGIISDRAARKANIGGELICEVS"
     atgagcatgc aagataccct ggcggatatg tttacacgta tccgtaacgc ccagatggcc        60
     aagaaagtac aggtagagat tcctgcttca aaagcaaagg aagctgttgc caaagtactg       120
     aaggacgagg gctacatcgc aggttacgaa gtaactggcg ataaaaaacc ggtaatgacg       180
     gttgagctta aatattacga aggcagtccg gtgatcgaga agattgcacg ggtaagccgt       240
     cctggtctgc gggtttataa gtccgcgggt gagatcccca aggttaaaga tggccttggt       300
     gttatgatcg tatccactaa tcagggcatt atttctgacc gcgcagcgcg caaagccaat       360
     attggtggcg agctgatctg cgaagtgtcc taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page