(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSI

AM286690.RPSI        Location/Qualifiers
FT   CDS_pept        635704..636099
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="ABO_0577"
FT                   /product="30S ribosomal protein S9"
FT                   /function="Ribosomal protein S9"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Ribosomal protein S9"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16025"
FT                   /db_xref="GOA:Q0VS23"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS23"
FT                   /protein_id="CAL16025.1"
FT                   /translation="MATVETNYGTGRRKTSSARVFLRPGSGKISVNGRPLDVYFGRKTN
FT                   QMVVRQPLELVEATDKFDVLVTVSGGGNNGQAGAIRHGITRALMEYDGELRGQLRRAGY
FT                   VTRDAREVERKKVGLRKARRRPQFSKR"
     atggcaactg tagaaaccaa ctacggaacc ggtcgccgca agacctcttc cgctcgcgtt        60
     tttctgcgtc cgggcagtgg caagatcagt gttaatggtc gcccgctgga tgtatatttt       120
     ggtcgtaaaa ccaaccagat ggttgttcgt cagcctctgg aactggtaga agcgactgat       180
     aagtttgatg tgctcgttac cgtaagtggt ggcggcaata acggtcaagc tggcgccatc       240
     cgccacggta tcacccgtgc gctgatggag tatgacggtg agctgcgtgg tcagctgcgt       300
     cgtgcaggct atgtgacacg tgatgcgcgt gaagtggaac gtaagaaagt gggtctgcgt       360
     aaggcgcgtc gtcgtccgca gttctccaag cgttaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page