(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSK

AM286690.RPSK        Location/Qualifiers
FT   CDS_pept        459659..460057
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="ABO_0420"
FT                   /product="30S ribosomal protein S11"
FT                   /function="Located on the platform of the 30S subunit, it
FT                   bridges several disparate RNA helices of the 16S rRNA.
FT                   forms part of the shine-dalgarno cleft in the 70S ribosome.
FT                   Subunit: part of the 30S ribosomal subunit. Interacts with
FT                   proteins S7 and S18. Cross-links to if-3."
FT                   /note="(ribosomal protein S11) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S11"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15868"
FT                   /db_xref="GOA:Q0VSI0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSI0"
FT                   /protein_id="CAL15868.1"
FT                   /translation="MAKSKKDSGARRKKVTRTVADGIAHVHASFNNTIITITDRQGNAL
FT                   SWATSGGAGFRGSRKSTPFAAQVAAENAGNAAKDYGLKNLEVRVKGPGPGRESSIRALN
FT                   GCGYKITHIEDVTPIPHNGCRPPKKRRV"
     atggctaagt caaagaaaga tagtggcgca cgtcgtaaga aggtaacgcg taccgttgca        60
     gacggtatcg cccacgtgca cgcttccttc aataacacca tcatcacaat cactgatcgt       120
     cagggcaatg cgttgtcttg ggcgacttct ggtggtgctg gtttccgtgg ttcccgtaaa       180
     agtaccccgt ttgctgccca ggtggcggct gagaacgcgg gtaacgcagc gaaggactac       240
     ggtctgaaaa atcttgaagt gcgggtgaaa ggcccaggtc cgggtcgtga atcttctatt       300
     cgtgccctga atggctgcgg ttacaagatc acccatattg aggacgtaac gccgattccc       360
     cataacggtt gccgtccgcc taaaaagcgt cgcgtgtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page