(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSL

AM286690.RPSL        Location/Qualifiers
FT   CDS_pept        427642..428013
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="ABO_0380"
FT                   /product="30S ribosomal protein S12."
FT                   /function="Interacts with and stabilizes bases of the 16S
FT                   rRNA that are involved in tRNA selection in the a site and
FT                   with the mRNA backbone. Located at the interface of the 30S
FT                   and 50S subunits, It traverses the body of the 30S subunit
FT                   contacting proteins on the other side and probably holding
FT                   the rRNA structure together. The combined cluster of
FT                   proteins s8, s12 and s17 appears to hold together the
FT                   shoulder and platform of the 30S subunit (by similarity)."
FT                   /note="(ribosomal protein S12) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S12"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15828"
FT                   /db_xref="GOA:Q0VSM0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSM0"
FT                   /protein_id="CAL15828.1"
FT                   /translation="MATVNQLVRKPRKSKVEKSDSVALQGCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDT
FT                   AGVQDRKQRRSKYGAKRPK"
     atggcaactg taaaccagct ggtgcgcaag ccgcgcaaaa gcaaggtaga aaagagcgac        60
     tccgtagccc ttcagggctg cccccagcgt cgcggcgttt gcacccgggt gtataccact       120
     accccgaaga agccaaactc cgcactgcgt aaagtgtgtc gtgtgcgtct gaccaacggt       180
     tatgaagtat cttcctacat tggtggtgaa gggcataacc tgcaggagca ctccgtagta       240
     ttgatccgtg gtggtcgtgt aaaagacctt cccggtgttc gctaccacac cgtacgtggc       300
     actctggata cggcaggcgt gcaggatcgc aagcagcgtc gttccaagta tggcgccaag       360
     cgtcctaagt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page