(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSM

AM286690.RPSM        Location/Qualifiers
FT   CDS_pept        459266..459622
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="ABO_0419"
FT                   /product="30S ribosomal protein S13"
FT                   /function="Located at the top of the head of the 30S
FT                   subunit, it contacts several helices of the 16S rRNA. In
FT                   the E.coli 70S ribosome it has been modeled to contact the
FT                   23S rRNA (bridge b1a) and protein L5 of the 50S subunit
FT                   (bridge b1b), connecting the 2 subunits; these bridges are
FT                   implicated in subunit movement. contacts the tRNAs in the a
FT                   and p-sites. Subunit: part of the 30S ribosomal subunit.
FT                   forms a loose heterodimer with protein S19. forms two
FT                   bridges to the 50S subunit in the 70S ribosome."
FT                   /note="(ribosomal protein S13) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S13"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15867"
FT                   /db_xref="GOA:Q0VSI1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSI1"
FT                   /protein_id="CAL15867.1"
FT                   /translation="MARIAGVNIPENKHTVISLTYIFGIGRTRAESICATTGIEQTAKV
FT                   RELTGEQLDAIRGEVAKFSTEGDLRREINMNIKRLMDLGCYRGIRHRRGLPLRGQRTKT
FT                   NARTRKGPRKPIRK"
     atggcccgta ttgcaggcgt taacatcccg gaaaataagc acacggtgat ttctctcacc        60
     tacatcttcg ggatcggtcg tacccgtgca gaatctatct gtgcaacgac cggtattgag       120
     cagaccgcga aagttcgcga gctgaccggt gagcaacttg acgccattcg tggcgaggtt       180
     gccaagttct ctaccgaagg tgacctgcgc cgggaaatca acatgaacat caagcgtctg       240
     atggacctcg gttgttaccg tggtattcgc catcgtcgcg gcttgccgct tcgcggtcag       300
     cgtaccaaga ccaatgcgcg tacccgtaaa ggtccgcgta aaccgattcg caaataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page