(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSN

AM286690.RPSN        Location/Qualifiers
FT   CDS_pept        454799..455104
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="ABO_0410"
FT                   /product="30S ribosomal protein S14"
FT                   /function="Known to be required for the assembly of 30S
FT                   particles and may also be responsible for determining the
FT                   conformation of the 16s rRNA at the a site."
FT                   /note="(ribosomal protein S14) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S14"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15858"
FT                   /db_xref="GOA:Q0VSJ0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSJ0"
FT                   /protein_id="CAL15858.1"
FT                   /translation="MAKESMKNREAKRTKLVQRFAAKRSALKAIIQDPNAEPEAKWDAQ
FT                   LQLQKLPRDSSPVRQRNRCRLTGRPHGYYRKFGLSRIKLREAAMRGDVPGLVKASW"
     atggctaaag aatccatgaa aaaccgggaa gcaaaacgca caaagctggt tcagcgtttt        60
     gccgccaagc gctcagcgct taaggcgatc atccaggatc ccaatgcaga acctgaagcg       120
     aagtgggatg ctcagcttca gctgcaaaaa ttgccgcgcg attcttctcc ggttcgtcag       180
     cgtaatcgct gtcgtctgac cggtcgtccg cacggttact accgcaaatt cggccttagc       240
     cggatcaagc tgcgtgaagc agcgatgcgc ggtgacgttc caggtctggt taaagccagc       300
     tggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page