(data stored in ACNUC7421 zone)

EMBL: AM286690.RRMJ

AM286690.RRMJ        Location/Qualifiers
FT   CDS_pept        351548..352174
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="ABO_0321"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /function="specifically methylates the uridine in position
FT                   2552 of 23s rrna in the 50s particle
FT                   (s-adenosyl-l-methionine + rrna = s-adenosyl-l-
FT                   homocysteine + rrna containing 2'-o-methyluridine)"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   FtsJ cell division protein"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15769"
FT                   /db_xref="GOA:Q0VSS9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSS9"
FT                   /protein_id="CAL15769.1"
FT                   /translation="MAKSSRSKTSKAWLKEHFNDPWVAKAQEQGYRSRASFKLLEMNEK
FT                   DRLFRPGMAVLDLGAAPGGWSQVAGQLIGGRGTVIASDILAMDALPDVTFIEGDFREEV
FT                   IYEQILMALGDQRADLVMSDMAPNMSGNSAVDQPRAMYLAELALDMAERVLEPDGVFLV
FT                   KVFQGEGFEDYRKALQSRFKRVVSRKPAASRARSTEVYQLGFGLK"
     atggcgaagt ccagccgttc caaaaccagc aaagcttggt taaaagagca ttttaacgat        60
     ccgtgggtag ctaaggccca ggagcagggt tatcgctcca gggccagttt caagctgctg       120
     gagatgaatg aaaaggaccg tttgttcagg ccgggcatgg cggtgctgga tttgggggcg       180
     gcccccgggg gctggagcca ggtggcgggt cagctgattg gcggcagggg cacggtgata       240
     gccagtgata ttcttgccat ggatgcttta ccggatgtga ccttcatcga aggggatttt       300
     cgtgaggagg tgatctatga gcaaatcctt atggcgctgg gggatcagcg ggcagacctt       360
     gtaatgtcgg acatggcccc caatatgagt ggtaatagcg cggtggatca gccgcgggct       420
     atgtatctgg cagagttggc gttggatatg gctgagcggg tgttggagcc tgatggtgtg       480
     tttctggtca aggtgttcca gggcgagggg tttgaagatt atcgcaaagc gctacaaagc       540
     cgcttcaaac gcgttgtcag tcgtaaaccg gcggccagtc gtgcccgctc tactgaagtt       600
     tatcagctgg gttttgggct gaaataa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page