(data stored in ACNUC7421 zone)

EMBL: AM286690.SECD

AM286690.SECD        Location/Qualifiers
FT   CDS_pept        551947..553860
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ABO_0503"
FT                   /product="Preprotein translocase SecD subunit"
FT                   /function="Involved in protein export. Subunit: part of the
FT                   prokaryotic protein translocation apparatus which comprise
FT                   secA, secB, secD, secE, secF, secG and secY."
FT                   /note="(protein-export membrane protein SecD) identified by
FT                   sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15951"
FT                   /db_xref="GOA:Q0VS97"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS97"
FT                   /protein_id="CAL15951.1"
FT                   /translation="MIKKSALLERTMTRYPRWKFFLLMAALVVCSLYALPNLYPDAPAI
FT                   QISHSEAGGEVSAVARQRVLSALDAAGLAHGDGEVVGSSLLVRMNDTEAQLRAKDIAAS
FT                   TLGDNYVVALNLAATTPQWLRDIGASPMNLGLDLRGGVHFLLQVDMDSVVKSRMEAWEG
FT                   TAKLTLRDAGVRYREVSVDGTTLIATFGDQVAADAARAPLRQALDKLAMQPAGDSPRIV
FT                   MTLNETALKEMQDYAVDQNRTALNKRVNELGVAEAVVQRQGADRIVVQLPGIQDAATAR
FT                   RILGRTATLEFRLVDNSVSSARLRSGMAPPGLEFFPFKGQEGRIVALNKSSIATGDQVI
FT                   DAKMGFDQQNGQPEVNVTLDSDGARRMQRVTGKNVGNPMGVLFIETKTDVKKVIDEDGN
FT                   SVEQMTSSTDKYVINVATIQSTLGSRFRITGLDNPAEASELALLLRAGSLAAPVSIVEE
FT                   RTVGPSLGAENIEAGLKSMALGLALVLAFMVLWYKVFGLIANVALLGNLVIIVGVMSLI
FT                   PGATMTLPGIAGIVLTVGMAVDANVLIFERIREDLRRGLSPRQAIEEGYARAFTTILDA
FT                   NITTLIVAVILFAAGTGSVQGFAVTLFIGILTSMFTAIIGTRAMAEMIYGRGARAPSKL
FT                   SI"
     atgattaaga aatcggcact actggaaaga actatgaccc gctatccacg ctggaaattt        60
     ttcctgctta tggctgcact cgttgtttgc agcctttatg cgcttcctaa tttgtacccg       120
     gatgcgcctg cgattcagat cagtcattcc gaggctggtg gcgaagtgtc ggctgtggct       180
     aggcagcgcg tattaagtgc cctggatgcc gccggcctgg cccatggaga cggtgaggtt       240
     gttggtagtt cattgctggt gcgtatgaac gataccgaag ctcagcttcg cgccaaggat       300
     attgcagcgt ctactttggg cgataattat gtggtggcgt tgaacttggc ggcaaccact       360
     cctcagtggt tgcgtgatat cggcgctagc cccatgaatt tggggttgga tctgcgtggc       420
     ggggttcact tcttgctgca ggtggacatg gattcggtgg tgaagagccg catggaagcc       480
     tgggaaggca ccgctaagtt gaccctgcgt gacgcagggg tgcgttatcg cgaggtgtct       540
     gtggatggca caaccctgat cgccaccttt ggagatcagg ttgctgcaga tgcagcgcgg       600
     gcgccattgc gccaggcgct ggacaagctg gccatgcaac cggccggaga tagccccaga       660
     attgttatga ccctgaacga aacggccctg aaagaaatgc aggactacgc cgtagaccag       720
     aaccgcaccg ctttgaacaa aagggtgaac gaactgggtg tggcggaagc ggtggttcag       780
     cgtcaggggg cagaccgtat cgtagtgcag ctgccaggca tccaggacgc ggccaccgcg       840
     cgtcggattt tgggccgcac cgcgacgctg gagtttcgtt tggtggacaa tagcgtgtcc       900
     tccgctcgcc tacgttctgg catggcgccg ccggggttgg agttttttcc gttcaagggg       960
     caagaaggcc ggatagtggc cttgaacaag tccagcattg ccaccgggga tcaggtgatt      1020
     gacgccaaga tgggctttga tcagcagaac ggtcaaccgg aagtcaacgt aacactggat      1080
     tccgatggcg cccgccgtat gcagcgtgtt accggcaaga acgtgggtaa ccccatgggg      1140
     gtgctgttca tcgaaaccaa gaccgacgtg aaaaaggtga tcgacgaaga cggcaacagc      1200
     gttgagcaga tgaccagcag cactgataag tacgtcatca acgtggcgac tattcagagc      1260
     accctgggta gccgtttccg gattaccggg ctggataacc cggcggaagc ctccgaattg      1320
     gcactgctgc tgcgtgccgg ctcactggct gcgccggtga gtatcgttga agagcgtacg      1380
     gttgggccga gcttgggcgc ggagaatatt gaagcgggcc ttaagtccat ggctttaggg      1440
     ctggcattag tgctggcctt catggtgctt tggtacaaag tatttggctt gattgctaat      1500
     gtggcgctgc tcggtaactt ggtaatcatt gttggtgtta tgtcgttgat tcccggcgct      1560
     accatgactc tgccgggtat tgccgggatc gtactgacgg tgggtatggc ggtagacgct      1620
     aacgttctga tcttcgaacg tattcgtgaa gatctgcgcc ggggtctgag tccacgccag      1680
     gctatcgaag aaggttacgc ccgtgcattt accactattc ttgatgccaa cattacgacc      1740
     ctgattgtgg cggtgatttt gtttgcagca gggaccggtt cggtacaggg ttttgcggtg      1800
     accttgttca ttggcatcct cacctccatg ttcacggcga ttatcggtac ccgtgccatg      1860
     gcagaaatga tttacggtcg aggcgctcgc gccccgagca aattgagcat ctga            1914
//

If you have problems or comments...

PBIL Back to PBIL home page