(data stored in ACNUC7421 zone)

EMBL: AM286690.SECE

AM286690.SECE        Location/Qualifiers
FT   CDS_pept        415378..415764
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="ABO_0372"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Protein secE/sec61-gamma protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15820"
FT                   /db_xref="GOA:Q0VSM8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSM8"
FT                   /protein_id="CAL15820.1"
FT                   /translation="MHRQMSEKTEARSGSAAFEAVKWLLVVGFVAAAVVGNSYFSDQPT
FT                   LYRVIGVVAVSLVAVFVALQTEQGKAFNQLRKDSLVELRKIVWPTRQETLQTTLIVLVF
FT                   VVIVALLLFVLDWILGGLMSWVIG"
     gtgcatcgtc agatgagcga gaaaacagaa gcgcgttccg gctctgccgc ctttgaggcg        60
     gtgaagtggt tgttggttgt ggggtttgtt gctgcggccg tagtgggcaa tagctatttc       120
     tccgaccagc cgaccctcta tcgagtaatc ggtgttgttg ctgtttctct ggtggcggta       180
     tttgttgctc tgcagactga gcagggcaag gcattcaatc agctgcggaa ggactccttg       240
     gttgagctgc gcaaaattgt gtggccgacg cgtcaggaaa ccctgcaaac tacgctgatt       300
     gttctggtct ttgttgtgat tgtagccctg ttgctttttg tgctcgactg gattctcggt       360
     ggacttatgt cctgggttat tggctaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page