(data stored in ACNUC7421 zone)

EMBL: AM286690.SECF

AM286690.SECF        Location/Qualifiers
FT   CDS_pept        553868..554791
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ABO_0504"
FT                   /product="Preprotein translocase SecF subunit"
FT                   /function="Involved in protein export. subunit part of the
FT                   prokaryotic protein translocation apparatus which comprise
FT                   secA, secB, secD, secE, secF, secG and secY."
FT                   /note="(protein-export membrane protein SecF) identified by
FT                   match to PFAM protein family HMMPF03631 InterPro:
FT                   SecD/SecF/SecDF export membrane proteins"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15952"
FT                   /db_xref="GOA:Q0VS96"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS96"
FT                   /inference="protein motif:HMMPFAM:HMMPF03631"
FT                   /protein_id="CAL15952.1"
FT                   /translation="MSKAPMNINFMAARKPLGVLSLALVIISVVLLLTRGLNLGLDFTG
FT                   GTTVVVKSPTDVELSQARDDLTEAGFGDAVVQHYGSPKEVNIRVAPKDDADADKVGQNV
FT                   FNVLKEHNADLELLKVEFVGPQVGDELRDESGTAMLLALGLMMLYVWFRFSNKFGVATV
FT                   LALFHDVIIVLGLFALIQWPFDLTVLAAVLALIGYSLNDSIVVADRIREDFRSTRETDP
FT                   VAIINGAVNQTFTRTINTSVTTLLVLVALYFFGGEVMRAFSEALLVGVLVGTYSSIYVV
FT                   SNILFMMKVSKEDFMIPEPEEVDEMP"
     atgagtaaag cacccatgaa catcaatttt atggccgccc gcaaaccgct gggtgttctg        60
     tcgctggcgt tggtaattat ttccgtcgta ttgttgctga cccgagggct caacctgggc       120
     ttggacttta ccggtggtac gacggtcgtg gtgaaaagcc cgacagatgt ggagctgtcc       180
     caagcccgtg atgatcttac tgaggccggc ttcggcgatg ccgttgtgca gcattacggc       240
     tcacctaagg aggtgaatat ccgtgttgca cccaaggacg atgcggatgc ggataaagtc       300
     ggccagaatg tcttcaatgt gcttaaagag cacaatgcag atctggaact actgaaagta       360
     gagtttgttg gtcctcaggt gggtgacgaa cttcgtgatg aatccggcac cgccatgcta       420
     ttggcccttg gcttgatgat gctgtacgtg tggtttcggt tctccaacaa gttcggtgta       480
     gctaccgtac ttgcactgtt tcacgatgtg atcattgtgc tggggttgtt tgcactgatt       540
     cagtggcctt tcgacctgac ggtgctggcg gcggtgctgg cgctgatcgg ttactcgctt       600
     aacgactcca tcgtggtggc tgaccggata cgggaagatt ttcgcagtac ccgggagacg       660
     gatccggtgg ctatcattaa tggtgcggtg aaccagacct ttacccggac gattaacacc       720
     tcggttacta ctttgctggt attggtggcg ttgtacttct ttggtggcga agtgatgcga       780
     gctttctctg aggcattgct ggtgggggtt ttagtgggta cctattcgtc catctatgtg       840
     gtgagcaaca tcctcttcat gatgaaggtc agcaaggaag actttatgat tccggagccg       900
     gaagaagtgg atgaaatgcc gtaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page