(data stored in ACNUC7421 zone)

EMBL: AM286690.SECY

AM286690.SECY        Location/Qualifiers
FT   CDS_pept        457632..459014
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="ABO_0417"
FT                   /product="Preprotein translocase SecY subunit"
FT                   /function="Involved in protein export. Interacts with secA
FT                   and secE to allow the translocation of proteins across the
FT                   plasma membrane, by forming part of a channel. subunit one
FT                   of seven secretory proteins (seca-f & secy) that comprise
FT                   the prokaryotic protein translocation apparatus."
FT                   /note="(Sec-dependent secretion protein SecY) identified by
FT                   sequence similarity;putative InterPro: SecY protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15865"
FT                   /db_xref="GOA:Q0VSI3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSI3"
FT                   /protein_id="CAL15865.1"
FT                   /translation="MAKNRAQTLNGGAPKADGNAMRELWRRIGFLLGALVVFRVGAHIP
FT                   VPGMNPEALQQMFNNNRDTILGLFNMFSGGSLERMSIFALGIMPYITASIVIQLMTAVV
FT                   PTLEQLRKEGEQGRRKITQYTRYLTVVLGAIQSFGMVAGLNSQGITLLPETASTMQLAS
FT                   FYFVAVSTLVTGTVFLMWLGEQITERGIGNGISMLIFASIVSGLPGAVAQTFESARTGD
FT                   LSLIMMLFVFLVAMAVIFGVVYVERGQRRITVNYARRQQGRRVYAAQQSHLPLKVNMAG
FT                   VIPAIFASSILLFPASLTQWFSDSNPDSWWGQALRNVSEALLPGTPLYILLFTLAIVFF
FT                   CYFYTALVFNPKDVADNLKKSGAYIPGIRPGEQSARYIDTVMGRLTLIGAVYMTLVCLL
FT                   PLGLQAVANVPFYLGGTSLLIVVVVVMDFWSQVNSHLTSTQYEKLMKKSNLKGYGGTGL
FT                   VR"
     atggcgaaga atcgcgctca aacactaaat ggtggtgcgc ccaaagcaga cggtaacgca        60
     atgcgtgaac tctggcggcg tatcggtttt ctgttgggcg ccttggtggt gttcagggtc       120
     ggggcgcata tcccggtccc gggcatgaac ccggaagcgt tgcaacagat gttcaacaac       180
     aaccgggaca ccattcttgg cctgtttaac atgttctctg gtggctcact ggagcgcatg       240
     agtatttttg cgttgggcat tatgccctat atcacggcta gcattgttat tcagctgatg       300
     actgctgtgg taccaaccct agaacagctt cgcaaagaag gtgaacaggg gcggcgtaaa       360
     ataacccaat acacacgtta cctaacggtg gttttggggg cgatccagtc ttttggcatg       420
     gttgccggtc tcaatagcca aggcattaca ctgctgccgg agacggccag cactatgcag       480
     cttgccagct tctattttgt tgctgtcagc acattggtta ctggtaccgt tttcctgatg       540
     tggctgggtg aacaaattac agagcgcggt atcggcaacg gtatttccat gctgattttc       600
     gcctctattg tgtcaggcct gcctggtgcg gtagcacaga cctttgagtc tgcgcgaacc       660
     ggagatctga gcctgatcat gatgttgttt gtgttcctgg ttgccatggc cgtgattttc       720
     ggtgtggtct atgtggaacg tggacagcgt cgtattaccg taaattacgc acgtcgccaa       780
     caaggccgtc gagtgtatgc ggcgcagcag agtcatctgc cgctgaaagt gaacatggca       840
     ggcgttattc ctgcgatttt tgccagctca atactattgt ttccggcgtc attgacccag       900
     tggttcagtg actccaatcc ggattcttgg tggggtcagg cattgcgcaa tgtgagtgaa       960
     gctctgctgc cgggtacgcc gctgtatatt ttgctgttta ccttggcaat tgtattcttt      1020
     tgctactttt atacagcgct ggtgtttaat ccgaaggatg tcgctgacaa cctgaagaaa      1080
     tccggcgctt atattccggg cattcgcccg ggcgagcagt ccgctcgcta tatcgacaca      1140
     gtgatgggcc gtttgactct gatcggtgcg gtatacatga cgctggtgtg cttactgccg      1200
     ctgggtctgc aagctgttgc caatgtgccc ttctacttgg gtggtacctc tttgctgatc      1260
     gtcgtggttg tggtaatgga cttctggtca caggttaatt cgcacctgac gtccacccag      1320
     tacgagaagt tgatgaagaa atccaacctg aaagggtatg gtggcaccgg tctggtgcgt      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page