(data stored in ACNUC7421 zone)

EMBL: AM286690.SERA

AM286690.SERA        Location/Qualifiers
FT   CDS_pept        70979..72208
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="ABO_0068"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="3-phosphoglycerate + NAD(+) =
FT                   3-phosphohydroxypyruvate + NADH."
FT                   /EC_number="1.1.1.95"
FT                   /note="identified by sequence similarity; putative
FT                   identified by match to PFAM protein family HMMPF02826
FT                   InterPro: D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15516"
FT                   /db_xref="GOA:Q0VTE6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE6"
FT                   /inference="protein motif:HMMPFAM:HMMPF02826"
FT                   /protein_id="CAL15516.1"
FT                   /translation="MADTSLEKDKIRVLLLEGIHENAVENLKANGYSNVELLPTALTGD
FT                   DLTAKIKDAHFVGIRSRTQLTEEVFEAAEKLIGVGCFCIGTNQVDLKAALKRGIPVFNA
FT                   PYSNTRSVAELVIAHTINMMRGIPEKNAVAHRGGWLKSAKDSYEIRGKTLGIVGYGNIG
FT                   AQVSVLAESMGMRVKFYDVVPKLPLGNAEQVGTLTDLLAQSDVVSLHVPDTADTRWMIQ
FT                   EEQIRAIKPKGYLINYARGKVVDIEALAAALNDGHLLGAAIDVFPEEPKGNDDEFISPL
FT                   REFDNVILTPHIGGSTKEAQVNIGTEVSEKLIRYSDNGATLGAVNFPEVALPPHPDMHR
FT                   LLHTHKNVPGVLTQINTVFSENGINICGQYLQTNEEIGYVVIDVDKGYSQLALEKLRTI
FT                   DGTIRTRVLF"
     atggccgata cttctcttga gaaggataag atccgcgttc tcctgctcga gggcatccac        60
     gaaaacgccg tggagaacct gaaagcgaat ggttactcca atgtggagct gctgcccacc       120
     gcgctcaccg gggatgacct gactgccaaa atcaaggatg ctcattttgt tggcatccgc       180
     tcccgcaccc agctcaccga agaggtgttt gaggcagcgg aaaaactgat tggcgttggc       240
     tgtttctgta ttggcactaa ccaggtagac ctgaaggccg ccctgaagcg tggtatcccg       300
     gttttcaacg cgccttactc caacacccgc tcggtggcgg aattggtgat tgctcacacc       360
     atcaatatga tgcgcggcat tccggaaaag aatgcggttg cccaccgtgg tggctggctg       420
     aagtctgcca aggacagtta cgagatccgt ggcaagacct tgggtatcgt gggttacggc       480
     aacatcggtg cgcaagtgag cgtgttggct gaatccatgg gcatgagagt aaagttctac       540
     gacgtggtac ctaagctgcc gctgggtaac gctgagcagg tgggtactct cactgatctg       600
     ctggcccagt ctgatgtggt gagcctgcac gtgccggaca ctgctgatac ccgctggatg       660
     attcaggaag agcagatccg tgcgatcaag cccaagggtt acctgatcaa ttatgcgcgc       720
     ggcaaggttg tcgacattga agcgttggcg gcggccctga acgacggcca cctgttgggc       780
     gcggccatcg atgtgttccc ggaagagccg aaaggtaacg atgacgagtt catcagcccg       840
     ctgcgcgaat tcgataatgt gattctgact ccgcacattg gtggctccac caaggaagcc       900
     caggtcaaca tcggtacgga agtgtccgaa aagctgatcc gttattccga caacggcgct       960
     accttaggtg cggtgaattt cccggaagtg gctctgcccc cgcatccaga tatgcaccgc      1020
     ctgcttcaca cccacaagaa cgtgcccggc gtgctgactc agatcaacac ggttttctcc      1080
     gaaaatggca tcaacatttg tggccagtac ctgcaaacca acgaagagat tggttacgtg      1140
     gttattgatg tggataaggg ctacagccaa ttggcgctgg aaaagctacg cactatcgac      1200
     ggcaccattc gtacccgggt gctgttctag                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page