(data stored in ACNUC7421 zone)

EMBL: AM286690.SFSA

AM286690.SFSA        Location/Qualifiers
FT   CDS_pept        383539..384258
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ABO_0347"
FT                   /product="sugar fermentation stimulation protein, putative"
FT                   /function="The sugar fermentation stimulation protein is a
FT                   probable regulatory factor involved in maltose metabolism"
FT                   /note="(sugar fermentation stimulation protein)"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15795"
FT                   /db_xref="GOA:Q0VSQ3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSQ3"
FT                   /protein_id="CAL15795.1"
FT                   /translation="MKFDPPLETVTLLRRYKRFMADVVRADGSEITVHCPNTGSMKNCV
FT                   LGGPQQALISDSGNPKRKYRHTLEALQVAHGHWAGVNTARPNALVEEAVRAGQFPMLDS
FT                   TSGVEREVKYGDSRFDLALGERADPHTFIEVKNVTLGPGPDDKDDGVIAFPDSVTERGQ
FT                   KHLQTLMDVVASGKRAVLFFCVQHSGATAARPADEIDARYGQLLREAIENGVEVLAWKS
FT                   EVSAQCFRLKEPLPLDL"
     gtgaagtttg atcccccgct ggaaaccgta acgctattgc ggcgctacaa acggtttatg        60
     gcagatgtgg ttcgcgccga tggcagcgaa attaccgtgc actgcccgaa caccggctcc       120
     atgaaaaatt gtgtgttggg cgggccacag caggcgctga tttcggatag tggcaatccg       180
     aaacgcaaat atcgccacac cctggaagcc ttgcaggtgg ctcacggcca ctgggccggg       240
     gtcaataccg cccgccccaa tgcgttggtg gaagaagcgg tgcgggccgg acagttcccc       300
     atgctggatt caaccagtgg cgtggagcgg gaggtgaaat acggggacag tcgctttgac       360
     ctggcgctgg gcgagcgggc cgacccacat acctttattg aagtgaaaaa cgtcaccctg       420
     ggtccggggc cagatgacaa ggatgacggc gtcatcgctt ttccggattc ggtcaccgag       480
     cggggccaga agcacttgca gacgctgatg gatgtggtcg cgtcgggaaa acgcgcggtg       540
     ttgttctttt gcgttcagca cagtggcgcc acggcggcgc gaccggcgga tgagatcgat       600
     gcccgctatg gacagttgtt gcgcgaggcg atagagaatg gcgtggaggt gctggcctgg       660
     aagagcgagg tgtcggcgca gtgcttcagg ctaaaagagc cgttgcccct tgatttgtag       720
//

If you have problems or comments...

PBIL Back to PBIL home page