(data stored in ACNUC7421 zone)

EMBL: AM286690.SSPB

AM286690.SSPB        Location/Qualifiers
FT   CDS_pept        639573..639980
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="ABO_0582"
FT                   /product="stringent starvation protein B"
FT                   /function="stringent starvation protein B (SspB), is
FT                   thought to enhance the specificity of degradation of
FT                   tmRNA-tagged proteins by the ClpXP protease. The tmRNA tag,
FT                   also known as ssrA, is an 11-aa peptide added to the C
FT                   terminus of proteins stalled during translation, targets
FT                   proteins for degradation by ClpXP and ClpAP. SspB a
FT                   cytoplasmic protein that specifically binds to residues 1-4
FT                   and 7 of the tag."
FT                   /function="Binding of SspB enhances degradation of tagged
FT                   proteins by ClpX, and masks sequence elements important for
FT                   ClpA interactions, inhibiting degradation by ClpA [1].
FT                   However, more recent work has cast doubt on the importance
FT                   of SspB in wild-type cells [2]. SspB is encoded in an
FT                   operon whose synthesis is stimulated by carbon, amino acid,
FT                   and phosphate starvation. SspB may play a special role
FT                   during nutrient stress, for example by ensuring rapid
FT                   degradation of the products of stalled translation, without
FT                   causing a global increase in degradation of all ClpXP
FT                   substrates"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16030"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS18"
FT                   /protein_id="CAL16030.1"
FT                   /translation="MSEMTSNRPYLIRAIHEWICDNGLTTHLAVNAGFPGVEVPQDFVQ
FT                   DGQIVLNIAPRAVTQFVADNDEIAFSARFGGMPMTIRVPINAVVAIFARENGQGMAFDP
FT                   VDPPEPPTPTTPELEKKDQGRGKVSHLKVVK"
     atgtctgaaa tgacgtccaa tcgcccgtat ctgatacggg ccatccacga gtggatctgc        60
     gacaatggct tgaccaccca tttggcagtg aatgccggtt tcccgggtgt ggaagtgcca       120
     caggattttg tccaggacgg tcaaatcgtt ctgaacatcg ctccacgcgc cgtgactcag       180
     tttgtggcgg ataatgatga gatcgctttt tctgcgcgtt ttggcggtat gcccatgacg       240
     attcgggtgc cgataaatgc tgtggtggcg atcttcgccc gtgaaaatgg tcaaggtatg       300
     gcgtttgacc cggtagaccc gccggagcca ccgactccga ctactcctga gcttgaaaag       360
     aaagaccaag gtagagggaa ggtcagtcac ttgaaggtgg ttaagtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page