(data stored in ACNUC7421 zone)

EMBL: AM286690.SUHB

AM286690.SUHB        Location/Qualifiers
FT   CDS_pept        complement(563725..564543)
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="ABO_0512"
FT                   /product="myo-inositol-1(or 4)-monophosphatase"
FT                   /function="biosynthesis of free myo-inositol from
FT                   inositol-1-phosphate"
FT                   /EC_number="3.1.3.25"
FT                   /note="(myo-inositol-1(or 4)-monophosphatase (extragenic
FT                   suppressor protein SuhB)) identified by sequence
FT                   similarity; putative InterPro: Inositol monophosphatase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15960"
FT                   /db_xref="GOA:Q0VS88"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS88"
FT                   /protein_id="CAL15960.1"
FT                   /translation="MHAPQVNIALRAARQAGTLIRRAAESSDPLSVTQKGMNDFVTEVD
FT                   RAAEARIIDVIRKAYPDHSILAEESGALEGSGDGKDYQWIIDPLDGTTNFIHGFPQYCV
FT                   SIALKYKGKMEHAVIYDPNRDEEFTASRGRGAALNGRRIRCTNRAGLEGCLIGTGFPFR
FT                   KDQAPHMDAYLGMFADVAAATAGLRRPGSAALDLAWLAAGRLDGFFEFGLAEWDMAAGV
FT                   LLITEAGGLVGDLSGGHKYLESGGIVAGSPKVFKGLLQKIKPHLTETLKR"
     atgcatgcgc cgcaagtgaa tatcgccctg cgagccgccc gtcaggcggg tactctgatt        60
     cgtagagctg ccgaaagcag tgatccctta tcagttacgc aaaaaggcat gaacgacttc       120
     gttaccgaag tagatcgtgc tgcagaagca cgcatcatcg atgtgatccg caaggcctac       180
     ccggaccaca gcattctggc tgaagaatcc ggtgctctcg aaggcagtgg cgacggcaaa       240
     gactaccagt ggatcatcga cccactggac ggcacgacca acttcattca tggcttcccg       300
     caatattgcg tctccattgc ccttaaatac aaaggcaaaa tggagcatgc cgtgatctac       360
     gatcccaacc gcgacgaaga attcaccgcc agccgtggcc gcggcgccgc cctcaacggc       420
     cgccgcatcc gctgcaccaa ccgagcaggg ctagaaggtt gcctgattgg caccggcttc       480
     ccgttccgta aagaccaggc gccgcatatg gacgcctact taggcatgtt cgccgatgtg       540
     gccgcggcca ccgccggctt acgccgcccc ggttctgcgg cactggatct ggcctggctg       600
     gccgccggcc gattggatgg tttctttgaa ttcggcttgg ccgaatggga catggccgcc       660
     ggagtactgt taattaccga agcaggcggc ttggtgggcg acctgagcgg tgggcataaa       720
     tacctggaaa gcggtggcat cgtcgccggc agtccaaagg tctttaaggg gctgctacaa       780
     aaaatcaaac cgcacctgac ggaaacgctg aaacgctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page