(data stored in ACNUC7421 zone)

EMBL: AM286690.TGT

AM286690.TGT         Location/Qualifiers
FT   CDS_pept        550288..551409
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ABO_0501"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /function="trna guanine + queuine = trna queuine + guanine"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Queuine and other tRNA-ribosyltransferase Queuine
FT                   tRNA-ribosyltransferase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15949"
FT                   /db_xref="GOA:Q0VS99"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS99"
FT                   /protein_id="CAL15949.1"
FT                   /translation="MSRMTFKLSTTDGAARRGEITFPRGTIQTPAFMPVGTYGTVKSML
FT                   PRDLADTGAEICLGNTFHLMLRPGTEVIEAHGSLHGFMQWDKPILTDSGGFQVFSLGEM
FT                   RKISEQGVVFRNPINGDKVELSPEKAMQVQRSLGSDICMIFDECTPFPATEKQARDSME
FT                   LSLRWAKRSKDAHEGNDAACFGIVQGGMYDDLRRESLAGLVDIGFDGYAVGGLSVGEPQ
FT                   NEMLRTLGNLTPHMPEDHPRYLMGVGKPDDIVEAVRRGVDMFDCVMPTRNARNGHLFIA
FT                   EGVVKIRNARHRHDLAPLEAECDCYTCQNFSRSYLHHLDRCNEMLGSQLNTIHNLRYYQ
FT                   RLMAGLRGAIEGGTLSAFVDDFYAARGQQTPAL"
     atgtcccgaa tgacgttcaa gctcagcacc accgacggtg ctgcccgccg tggtgaaatt        60
     acgtttcccc gcggcaccat tcaaacgccg gcctttatgc cggtaggcac ctatggcacg       120
     gtgaaaagca tgctgcctag ggatcttgcc gatactggcg ccgagatttg tctgggaaac       180
     accttccatt tgatgctgcg cccgggcact gaagtcattg aggctcacgg ttccttgcat       240
     ggctttatgc agtgggacaa accgatcttg acggattccg gcggctttca ggtgttcagc       300
     cttggtgaga tgcgcaagat ttccgagcag ggcgtggtgt tcagaaaccc tatcaatggt       360
     gacaaggttg aactgagccc ggaaaaagcc atgcaggtac agcgctcgct gggcagcgat       420
     atctgcatga tctttgatga atgcactcct ttcccggcca ctgaaaaaca ggcccgtgat       480
     tccatggagc tgtccctgcg ctgggcgaag cgctcaaaag acgcccatga aggcaatgat       540
     gccgcctgtt tcggtatcgt gcagggtggc atgtatgatg atctgcgccg cgaatccctg       600
     gccgggctgg tggatattgg ctttgacggc tacgcggtag gtggcttgag tgtgggcgag       660
     ccccagaacg agatgttacg aacgctgggt aatctgaccc cgcatatgcc ggaagaccac       720
     ccccgttact tgatgggcgt gggtaagccg gatgatattg ttgaggcggt acgccggggg       780
     gtggacatgt ttgattgcgt gatgcctacc cgcaatgccc gcaatggcca cctgttcatc       840
     gccgaagggg tggtgaaaat tcggaatgcc cggcaccgcc atgatctggc tcctctggag       900
     gcagagtgtg actgttatac ctgccagaat ttctcccgca gctatttgca ccatctggat       960
     cggtgcaatg aaatgctggg ctcccagctc aatactatcc ataacctgcg gtattaccag      1020
     cggttgatgg ctggattgcg gggggccatt gaagggggta cattgtccgc ctttgtggac      1080
     gacttttatg cagcccgagg tcaacaaacc ccggcgctgt ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page