(data stored in ACNUC7421 zone)

EMBL: AM286690.TPIA

AM286690.TPIA        Location/Qualifiers
FT   CDS_pept        356487..357230
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="ABO_0325"
FT                   /product="triosephosphate isomerase"
FT                   /function="d-glyceraldehyde 3-phosphate = glycerone
FT                   phosphate."
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF00121"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15773"
FT                   /db_xref="GOA:Q0VSS5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSS5"
FT                   /inference="protein motif:HMMPFAM:HMMPF00121"
FT                   /protein_id="CAL15773.1"
FT                   /translation="MNRTPLVAGNWKMNGRKDLLTEMADALAGYAGAAEVVICPPFPYL
FT                   AAARSAMPGAVGIGSQNVSEQEDGAFTGEVSAPMLAEVGCGYVIIGHSERRALYGETDA
FT                   QIASKFAHAQAAGLVPILCVGETLEERDSGNTDTIVCGQLRAVVDAVGVAAFANAIVAY
FT                   EPVWAIGTGKTASPEQAQAVHACLRQFLAKDDPDIAQSLRLLYGGSVKADNAALLFAQS
FT                   DIDGGLIGGASLTADSFIAICQAAE"
     atgaatagaa cccctctggt tgcgggcaac tggaaaatga acgggcgcaa ggacttgctt        60
     accgaaatgg cagacgctct ggcgggttat gctggtgctg ctgaggtggt catctgtcca       120
     ccttttccgt atttggctgc ggccagatct gcgatgccgg gggccgttgg tatcggtagc       180
     cagaacgtga gtgagcaaga ggatggcgct tttaccggag aggtatctgc gccgatgcta       240
     gccgaggtgg gctgtggtta cgtgattatt gggcattccg agcgccgtgc gttatacggt       300
     gaaacggatg cgcagattgc cagcaagttc gcccacgctc aggctgcggg tctggtgccg       360
     attctttgcg tgggtgaaac gctggaagag cgtgactctg gcaatactga caccatcgtc       420
     tgtgggcaat tacgcgcggt tgtggatgcg gttggcgttg cggcttttgc taatgcgata       480
     gtggcctatg agccggtctg ggcgatcggc actgggaaga cggctagccc cgagcaggct       540
     caagctgttc acgcttgttt gcgtcaattt ttagcgaaag acgacccgga tatcgctcaa       600
     tcgctgcggt tgctttacgg cggcagcgta aaggcggata atgccgccct tctatttgcc       660
     cagtcagaca tcgatggggg tctgatcggt ggggcatcgt taacagccga cagctttatt       720
     gcgatctgtc aggcggcgga ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page