(data stored in ACNUC7421 zone)

EMBL: AM286690.TRKA

AM286690.TRKA        Location/Qualifiers
FT   CDS_pept        complement(138486..139862)
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="ABO_0128"
FT                   /product="potassium uptake protein"
FT                   /note="(potassium uptake protein TrkA) identified by match
FT                   to PFAM protein family HMMPF02080 InterPro: KTN NAD-binding
FT                   domain"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15576"
FT                   /db_xref="GOA:Q0VTE4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE4"
FT                   /inference="protein motif:HMMPFAM:HMMPF02080"
FT                   /protein_id="CAL15576.1"
FT                   /translation="MKIIILGAGQVGGTLAENLANERNDITVIDTDDERLRELGDRLDI
FT                   GTVRGMGCYPAVLKNAGAEDADMLIAVTNSDEVNMIACQVAYSLFRTPSKIARIRTAHY
FT                   TSRSEKLFNENALPIDVIISPEQVVTDYIKRLIEHPGALQVVNFAGGRVQLVAVRAYYG
FT                   GPLVGNELRELRTHMPNVDTRVAAIFRRGRPIIPEGNTVIEADDEVFFIAAKNDIRAVM
FT                   SELRRLEHNYKRIIIAGGGNIGYRLAKTIQHRYNVKVLERMPKRAEWLGEKLHQTVVLQ
FT                   GLATDRDELLKANIENTDVFCALTNDDEANIMASLLAKRLGARKVMTLISNPAYVDLVQ
FT                   GHDIDIAISPQQSTIGSLLSHVRRGDVVNVYSLRRGAAEAIEAIAHGDAKSSKVVGRAI
FT                   DEIDLPEGTTIGAVVRGEKVLIAHDHVVIEPNDHVILFLIDKRRTRDVEKLFQVGFTFF
FT                   "
     atgaaaatta ttattctcgg tgctggccaa gtcggcggta ctctggccga aaacctggcc        60
     aatgaacgca acgacatcac cgtcatcgac accgatgatg agcgcctgcg cgagctgggc       120
     gaccggctag atatcggcac agtacgcggc atgggctgct acccggccgt actcaagaat       180
     gccggcgctg aagatgcgga catgctcatc gcggtgacca actctgacga ggtcaacatg       240
     attgcctgtc aggtggccta ctccctattc cgcacaccct ccaagatcgc ccgcattcgt       300
     accgcccact acaccagccg ctcggaaaaa ctgttcaacg aaaatgccct gcccattgat       360
     gtaatcatca gccccgaaca ggtggtaacc gattacatca agcgtctgat tgaacaccca       420
     ggtgccctgc aggtagtaaa ctttgccggc ggccgagtac aactggtcgc tgtgcgggcc       480
     tattacggcg gcccactggt gggcaacgaa ttacgcgaat tgcgcacaca catgcccaac       540
     gtggataccc gcgtggcggc tattttccgt cgtggccgcc ccatcatccc ggaaggcaac       600
     acggttatcg aagccgatga tgaagtgttt ttcatcgctg ccaaaaatga tatccgtgcc       660
     gttatgagtg aactgcgtcg gttagaacat aactacaagc gcatcattat cgctggcggc       720
     ggcaatattg gttaccgcct agccaaaact attcagcatc gctacaacgt taaagtcctt       780
     gagcgcatgc ccaaacgggc tgaatggctg ggtgaaaaac tacaccaaac agtggtgctg       840
     caagggttgg ccaccgaccg agacgaacta ctcaaagcca acatcgaaaa caccgatgta       900
     ttctgcgcgc tgaccaacga tgacgaagcc aacatcatgg cctcactgct ggcaaaacga       960
     ctgggcgctc gtaaagtgat gaccctgatt tccaacccgg cctatgtaga tctggtacaa      1020
     gggcatgaca ttgacatcgc catctcgcct cagcagtcca ccattggtag tctgcttagc      1080
     catgtgcgcc gaggcgatgt agtcaatgtt tattcccttc gccggggcgc ggcagaagcc      1140
     atcgaagcga ttgcccacgg cgacgccaag tcatccaaag tggtggggcg cgccattgat      1200
     gaaattgacc tgccagaagg caccaccatt ggtgccgtag tgcgcggcga aaaagtgctg      1260
     attgcccacg accatgtggt gatcgaaccg aacgatcacg tcatcctgtt cctgatcgat      1320
     aaacgccgaa cccgagacgt ggaaaaacta ttccaggtcg gctttacgtt tttttag         1377
//

If you have problems or comments...

PBIL Back to PBIL home page