(data stored in ACNUC7421 zone)

EMBL: AM286690.YADR

AM286690.YADR        Location/Qualifiers
FT   CDS_pept        397765..398217
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="ABO_0362"
FT                   /product="HesB/YadR/YfhF family protein"
FT                   /note="HesB/YadR/YfhF family protein identified by
FT                   sequencesimilarity; putative InterPro: Hypothetical
FT                   hesB/yadR/yfhF family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15810"
FT                   /db_xref="GOA:Q0VSN8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSN8"
FT                   /protein_id="CAL15810.1"
FT                   /translation="MRIILDCFSRVLEHDQSVQEGSYLSGFSSAQMSADSESMIESAPI
FT                   SFTDAAAAKVKELRDDEGNPNLKLRVYITGGGCAGFSYGFTFDETVNEDDTSVEKEGVI
FT                   LLVDAMSIQYLDGSVVDYEKGLMGSRFVVSNPNAATTCGCGSSFSV"
     gtgcggataa ttcttgactg ttttagtcgg gtactagaac atgatcagtc cgttcaggag        60
     ggttcgtacc tgagtggctt ttcttctgcc caaatgtcag ccgatagcga gagtatgatc       120
     gagtcagcac cgatttcatt taccgatgcc gccgccgcca aagttaaaga gctgcgtgac       180
     gacgaaggaa atccgaacct caagctgcgt gtttatatta ccggtggtgg gtgcgcaggg       240
     ttctcttatg gttttacttt cgatgagacg gtgaacgagg acgatacttc ggtagagaaa       300
     gagggtgtca ttttgctggt ggacgccatg agtatccagt atctggatgg ctccgtggtc       360
     gactacgaaa aaggcctgat gggctcacgt tttgtggtga gcaaccctaa tgcggctact       420
     acttgtggtt gcgggtcttc tttctcggtc tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page