(data stored in ACNUC7421 zone)

EMBL: AM286690.YGIX

AM286690.YGIX        Location/Qualifiers
FT   CDS_pept        complement(33315..33977)
FT                   /transl_table=11
FT                   /gene="ygiX"
FT                   /locus_tag="ABO_0031"
FT                   /product="transcriptional regulatory protein qseb"
FT                   /function="DNA binding"
FT                   /note="probable 2-component transcription regulator
FT                   identified by match to TIGR protein family HMMTIGR01387
FT                   InterPro: Response regulator receiver domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15480"
FT                   /db_xref="GOA:Q0VTM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTM8"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01387"
FT                   /protein_id="CAL15480.1"
FT                   /translation="MHILLIEDDALLGDGIQAGLQAMGFTVAWVTLARDGLAAWKSVDF
FT                   DALVLDLGLPDQEGSEALCQWREAGLTVPVLILTARDAVQDRIDGLQRGADDYLIKPFD
FT                   LGELAARLQALLRRTRGQARPFIEHGRLRVDPFRQQVWLADKEVELQRREMALLLALLQ
FT                   SQGRLLTADQLADRVYGWMDGVESNALTVHIHNLRRKLDSRIVETVRGGGYRLGAPL"
     atgcatattt tattgatcga agatgatgct ctgttaggcg acggtattca ggccggtcta        60
     caagccatgg gatttaccgt agcctgggtg acgcttgcgc gggacggcct ggccgcttgg       120
     aaaagcgtgg attttgatgc gttggtgcta gatctaggac tgcccgacca agagggtagt       180
     gaagcccttt gccaatggcg tgaggctggg ctgacggtgc cggtattgat cctcaccgcc       240
     cgagacgccg tgcaagaccg cattgatggc ttgcagcgcg gcgccgatga ttacctgatt       300
     aagccgtttg atttgggcga gctggcagcg cgcttacagg ccctattgcg tcgtacccgg       360
     ggccaagccc gtccgtttat tgagcatggc aggctacggg tcgatccgtt ccgacagcaa       420
     gtctggctgg cggataaaga agtggaattg caacggcggg aaatggcgtt gttgcttgct       480
     ttgttgcaaa gccagggtcg gttactcacg gcggaccaat tggccgaccg tgtttacggc       540
     tggatggacg gcgtggagag caacgctttg acggtacata tccataacct gcgccgcaaa       600
     ctggatagtc gcattgtgga aaccgtacgc ggtggcggtt accggttagg cgcgccgcta       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page