(data stored in ACNUC7421 zone)

EMBL: AM286690.ZNUA

AM286690.ZNUA        Location/Qualifiers
FT   CDS_pept        complement(163920..164783)
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="ABO_0155"
FT                   /product="High-affinity zinc uptake system protein znuA
FT                   precursor."
FT                   /function="COG: ABC-type Zn2+ transport system, periplasmic
FT                   component/surface adhesin"
FT                   /note="Periplasmic solute binding protein.identified by
FT                   sequence similarity"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15603"
FT                   /db_xref="GOA:Q0VTB7"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTB7"
FT                   /protein_id="CAL15603.1"
FT                   /translation="MRHFWLILLLFLGSPAWSQTVVASVEPLAKVLRSLYGEKITVTTL
FT                   MQGNQNPHQLALSPRQAMAVQQADLVVWLGADVEAPLAPLVARRKGRTVTLLELEGVYR
FT                   RKGEHQHHEDHDHEGHAASTDPHLWLSVDNMVLLAGAVGQQFPHGLTPGQPQLWQQEAK
FT                   AQLQAEKKQLMPLAQVPWLSYHQPWGYLTESLGLANPLVVSEQLGAGPGSRRFVTLAGQ
FT                   VRDQQVRCAVQEPEARAGLLKRLCPDCYVQPLDPLGRDSLQQKYLPWLSELSSGFAQCL
FT                   QAAKDT"
     atgcgtcatt tctggttaat ccttttgtta ttccttggct ccccagcctg gagtcagacc        60
     gtggtagcca gcgtggagcc gttggcgaag gtactgcgca gcctctatgg tgaaaaaatt       120
     acggtcacta ctttaatgca gggcaaccag aatccgcatc agctggcatt atcccctcgc       180
     caagcgatgg cggtgcagca ggcggatctg gtggtgtggt tgggcgcgga cgtggaggct       240
     ccactggcgc ctctggtggc gcgccgcaag ggccggactg tgaccttgct ggaactggaa       300
     ggcgtgtacc ggcgcaaggg tgagcatcag caccatgaag atcatgacca tgaggggcat       360
     gctgccagca ccgaccctca cctgtggtta tccgtggata atatggtgtt actggcgggc       420
     gccgtcggtc agcaatttcc gcacgggcta acgccgggcc agccccaatt gtggcagcag       480
     gaggccaagg ctcagttgca agccgagaaa aagcagttga tgccattggc gcaggtaccc       540
     tggctgagct atcaccagcc ttggggttat ctaaccgaaa gccttgggtt ggccaacccg       600
     ttggtggtat cagaacaact gggggccggg ccgggtagcc gtcgttttgt caccctggcg       660
     gggcaggtgc gagaccagca agtgcgttgc gcggttcagg aaccggaagc tcgggccggc       720
     ctgctcaaac gtctgtgccc agactgttac gtacagccgt tggatccgtt aggacgcgac       780
     tccttacaac agaagtacct gccctggttg tcagaattga gtagtgggtt tgctcaatgc       840
     ttacaagccg ccaaagacac ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page