(data stored in ACNUC7421 zone)

EMBL: AM286690.ZNUB

AM286690.ZNUB        Location/Qualifiers
FT   CDS_pept        165728..166576
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="ABO_0157"
FT                   /product="zinc ABC transporter permease protein"
FT                   /note="(zinc ABC transporter permease protein ZnuB)
FT                   identified by match to PFAM protein family HMMPF01032
FT                   InterPro: ABC 3 transport family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15605"
FT                   /db_xref="GOA:Q0VTB5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTB5"
FT                   /inference="protein motif:HMMPFAM:HMMPF01032"
FT                   /protein_id="CAL15605.1"
FT                   /translation="MITTMICTAMPRIPTITTGPAIMIELLLPPLLAGLAVALVSGPMG
FT                   AFVVWRRMAFFGDTLAHGALLGAALALALDISLYVAVVAVCLGLAAALSGLQRQRQLAG
FT                   DTLLGIVAHTTLALGVIAISLQTGIQVDLFAYLFGDLLAVGWQDVTGLWVGAMVILMLM
FT                   LWQWRALLSITVNEELAQVEGIAVQRTRLLLMLLLALLIAGAIRTVGVLLITSLLVIPA
FT                   ASARRLTHTPAQMAAVASVLGTLSVLVGLAVSWYANTPVGPSIVVAASSLFVLTLLRRG
FT                   S"
     atgatcacga ccatgatctg cacggcaatg ccacgcattc ccacgatcac aacgggccct        60
     gcaatcatga ttgaattgtt actgccgcca ttactggccg ggctggccgt ggcattggtc       120
     tccggcccca tgggtgcctt tgtagtgtgg cggcgcatgg cgttttttgg cgacaccctg       180
     gcccacggcg cgctattggg cgcagcgctg gcgctagcgc tggatatcag cctgtatgtg       240
     gcggtggtgg cggtgtgcct ggggctggct gccgccctca gcggcctgca gcggcaacgg       300
     caactggccg gagacaccct gcttggcatt gtcgcccaca ccaccctggc actcggggtc       360
     atcgccatta gcctgcaaac cggcatccag gtggatctgt tcgcctactt gttcggggat       420
     ttgctcgccg taggctggca ggatgtgacc ggcctgtggg taggcgccat ggtcattctg       480
     atgctgatgc tgtggcagtg gcgggcactg ctcagcatta ccgtcaacga agaactggcc       540
     caggtggaag gcatcgcagt acaacgcacc cggctattac tgatgttgtt gctggccctg       600
     ctgatcgccg gtgccatccg caccgtgggc gtgctgctga ttacctcgtt gctggtgatt       660
     cccgccgcca gcgcccgccg tctgacccat acgccagcac agatggctgc ggtggccagc       720
     gtgctgggca ccttgtcggt gctggtcggg ttggcggtaa gttggtacgc caacacgccg       780
     gtgggtccat ccatcgtggt ggccgccagc agcttgtttg tgctgacgct gttgcgcagg       840
     gggtcatga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page