(data stored in ACNUC7421 zone)

EMBL: AM286690.ZNUC

AM286690.ZNUC        Location/Qualifiers
FT   CDS_pept        165022..165801
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="ABO_0156"
FT                   /product="zinc transport protein, ATPase"
FT                   /function="COG: ABC-type Mn/Zn transport systems, ATPase
FT                   component"
FT                   /note="ABC-type Mn/Zn transport systems, ATPase component,
FT                   ABC transporter related, ABC transporter, ABC_phnC:
FT                   phosphonate ABC transporter, ATP-binding protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15604"
FT                   /db_xref="GOA:Q0VTB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTB6"
FT                   /protein_id="CAL15604.1"
FT                   /translation="MPEPLVTVQSVSVTLGGNAVLSDVSLSLAPGRITTLIGPNGAGKS
FT                   TLARLVLGLVQPDSNHGTVIRRKGLRVGYMPQHIKIDDSLPLTVDRFLWLAAPGPTASR
FT                   RAALERAGVAHLRRRGVQQLSGGEMQRVLLARALLRKPDLLVLDEPAQGVDVAGQNALY
FT                   GLLKTVRDELGCAILLISHDLHLVMAATDEVICLQRHVCCSGSPESVSRDPAYHELFGP
FT                   GAGTPNLALYTHDHDHDHDLHGNATHSHDHNGPCNHD"
     atgccagaac ctttggtcac tgtgcagtcg gtgtcggtta cgctaggagg caacgctgtg        60
     ctgtctgacg tcagcctgag cctggccccc ggtcgcatca ctacgctgat tggccccaac       120
     ggcgccggta agagcacgct ggcgcggctt gtactggggc tagtgcagcc agacagtaac       180
     catggcacgg tgatccgccg taaaggcctg cgggtgggtt acatgcccca gcacatcaag       240
     atcgacgaca gcctgccgct cacagtggac cgttttttgt ggttggcggc accggggcct       300
     acggcctccc gccgggcggc cttggagcgg gccggggtgg cccatctgcg tcggcgcggg       360
     gtgcagcagc tgtccggcgg agaaatgcag agggtactac tggcccgcgc cttgctgcgc       420
     aagccggatc tgttggtact ggacgagcct gcccagggcg tggatgtggc cgggcagaat       480
     gctctctatg gcctgctcaa gaccgttcgt gacgagctgg gctgtgccat cctgttgatt       540
     tcacacgatc tgcatctggt catggcggcc accgatgaag tcatttgctt acagcgccac       600
     gtttgctgtt ccggcagccc ggagtcggta agccgggacc cggcctacca cgagttgttc       660
     ggccccggtg ccggtacacc taacctggcg ctatacaccc acgatcatga tcacgaccat       720
     gatctgcacg gcaatgccac gcattcccac gatcacaacg ggccctgcaa tcatgattga       780
//

If you have problems or comments...

PBIL Back to PBIL home page