(data stored in ACNUC1104 zone)

EMBL: AM420293.CHB

AM420293.CHB         Location/Qualifiers
FT   CDS_pept        complement(137744..138349)
FT                   /transl_table=11
FT                   /gene="chb"
FT                   /locus_tag="SACE_0110"
FT                   /product="secreted chitin binding protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99463"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y9"
FT                   /protein_id="CAL99463.1"
FT                   /translation="MLAKRMKRTLGIALFALVPLTLPVVTAGMAQSHGFTQSPSSRQDA
FT                   CAQGKVSDCGTIVWEPQSVEGPKGFPQAGPADGKICSAGLAQFAELDDPRGGQWPATNV
FT                   SAGQDFTFTWKITAAHSTMSFRYFVTKDGWDPSQPLTRAALEPAPFVSQDLGGQRPPNT
FT                   YTHTGKLPNKSGKHVILGVWDIADTGNAFYSCADVNFG"
     gtgctcgcga aaagaatgaa acgcactctc ggcatcgcgt tgttcgccct cgtcccgctc        60
     acccttcccg tggtgaccgc cggaatggcg cagagccacg gattcaccca gagcccgtcg       120
     agccgccagg acgcgtgcgc gcagggcaag gtctccgact gcggcacgat cgtctgggag       180
     ccgcagagcg tcgagggccc gaagggcttc ccgcaggccg ggcccgccga cggcaagatc       240
     tgctccgccg ggctcgccca gttcgccgag ctcgacgacc cgcgcggcgg ccagtggccc       300
     gcgaccaacg tcagcgcagg tcaggacttc acgttcacct ggaagatcac cgcggcgcac       360
     tcgacgatgt cgttccgcta cttcgtcacc aaggacggct gggacccgtc gcagcccctg       420
     acccgggccg cgctggagcc cgcgccgttc gtcagccagg acctcggcgg ccagcgtccg       480
     ccgaacacct acacccacac cggcaaactt ccgaacaagt ccggcaagca cgtgatcctc       540
     ggcgtctggg acatcgccga caccgggaac gccttctact cgtgcgcgga cgtgaacttc       600
     ggttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page