(data stored in SCRATCH zone)

EMBL: AM420293.CLPC

AM420293.CLPC        Location/Qualifiers
FT   CDS_pept        463959..466520
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="SACE_0414"
FT                   /product="putative ATP-dependent Clp protease"
FT                   /function="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99762"
FT                   /db_xref="GOA:A4F6T8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T8"
FT                   /protein_id="CAL99762.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGIALEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVLQLLSGYQGKEPAEAGGRGEGTPSS
FT                   SLVLDQFGRNLTQSARESKLDPVIGREKEIERIMQVLSRRTKNNPVLIGEAGVGKTAVV
FT                   EGLAQKVVKGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEIKTRGDIILF
FT                   IDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLEEYRKYVEKDPALERRFQP
FT                   IQVGEPSLEHTIEILKGLRDRYEAHHRVSITDGALVSAATLADRYINDRFLPDKAIDLI
FT                   DEAGARMRIRRMTAPPDLREFDEKIADVRRDKESAIDAQDFERAARLRDEEKQLLGQKD
FT                   EREKQWKAGDLDVVAEVDDEQIAEVLANWTGIPVFKLTEEETTRLLRMEDELHKRIIGQ
FT                   DDAVKAVSQAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALAEFLFGDDDALVQI
FT                   DMGEFHDRYTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNTLL
FT                   QVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTQDISKAVGLGFSAGTDSESNYERMKSKV
FT                   NEEMKKHFRPEFLNRIDDVIVFHQLTEAEIIQMVDLLGARVEKALKGKDMSLELTTLAK
FT                   KLLAKRGFDPVLGARPLRRTIQREIEDRLSEKILFGEIEPGQIVIVDVEGWDGEGSDDK
FT                   AHFTFRGETKPSLVPDAPPVDLAGSTGSSTDDKSEGTSDQE"
     atgttcgaga ggttcaccga ccgcgcgagg cgggtggtcg tcctggccca ggaagaggcc        60
     cggatgctca accacaacta catcggcacc gagcacatcc tcctgggctt gatccacgag       120
     ggtgagggtg tcgccgccaa ggcgctggag tcgctgggta tcgcgcttga gggcgtgcgc       180
     cagcaggtcg aggagatcat cggccagggt cagcaggctc cgagcggtca catcccgttc       240
     accccgcggg ccaagaaggt gctggagctg tcgctgcgcg aggcgctgca gctggggcac       300
     aactacatcg ggaccgagca catcctgctc ggcctgatcc gcgagggcga gggcgtggcc       360
     gcgcaggtgc tggtcaagct cggcgcggac ctcaaccggg ttcgccagca ggtgctgcag       420
     ctgctgtcgg gttaccaggg caaggagccg gcggaggccg gcggccgcgg cgagggaacc       480
     ccgtcgtcgt cgctggtgct ggaccagttc ggccgcaacc tgacgcagag cgcccgcgag       540
     tccaagctcg acccggtcat cggtcgcgag aaggagatcg agcggatcat gcaggtcctc       600
     tcgcggcgca ccaagaacaa cccggtgctc atcggcgagg cgggcgtcgg caagaccgcc       660
     gtggtcgagg gcctggcgca gaaggtcgtc aagggcgagg tgcccgagac gctgaaggac       720
     aagcagctct acaccctcga cctgggttcg ctggtcgcgg gttcgcgcta ccgcggtgac       780
     ttcgaggagc gcctgaagaa ggtgctcaag gagatcaaga cccgcggcga catcatcctg       840
     ttcatcgacg agatccacac cctggtgggt gcgggtgccg ccgagggcgc catcgacgcg       900
     gcgagcatcc tcaagccgat gctggcccgc ggcgagctcc agacgatcgg tgcgaccacg       960
     ctggaggagt accgcaagta cgtcgagaag gacccggcgc tggagcgccg cttccagccg      1020
     atccaggtcg gcgagccctc gctggaacac accatcgaga tcctcaaggg cctgcgcgac      1080
     cggtacgagg cgcaccaccg ggtgtccatc accgacggcg cgctggtctc ggccgcgacg      1140
     ctggccgacc gctacatcaa cgaccgcttc ctgccggaca aggcgatcga cctgatcgac      1200
     gaggccggcg cccggatgcg catccgccgc atgaccgctc cgccggacct gcgcgagttc      1260
     gacgagaaga tcgccgacgt gcgccgggac aaggagtccg cgatcgacgc gcaggacttc      1320
     gagcgggccg cccgcctgcg cgacgaggag aagcagctcc tcgggcagaa ggacgagcgc      1380
     gagaagcagt ggaaggcagg cgacctcgac gtcgtcgccg aggtggatga cgagcagatc      1440
     gccgaggtgc tggcgaactg gacggggatt ccggtgttca agctcaccga ggaggagacc      1500
     acgcgtctgc tccgcatgga ggacgagctg cacaagcgga tcatcggcca ggacgacgcg      1560
     gtcaaggcgg tctcgcaggc gatccggcgt acccgtgcgg ggttgaagga ccccaagcgc      1620
     ccgtcggggt cgttcatctt cgccggcccg tccggtgtcg gtaagaccga gctgtccaag      1680
     gcgctggcgg agttcctgtt cggcgacgac gacgcgctgg tgcagatcga catgggcgag      1740
     ttccacgacc gctacaccgc ctcgcggctg ttcggtgccc cgcccggcta cgtcggctac      1800
     gaggagggcg gccagctcac cgagaaggtg cgtcgcaagc cgttctcggt ggtgctgttc      1860
     gacgagatcg agaaggccca ccaggagatc tacaacacgc tgttgcaggt gttggaggac      1920
     gggcgtctga ccgatggtca ggggcgcacg gtggacttca agaacacggt gctgatcttc      1980
     acctcgaacc tgggtaccca ggacatctcc aaggccgtgg ggctgggctt ctcggccggg      2040
     accgactccg agtccaacta cgagcggatg aagagcaagg tcaacgagga gatgaagaag      2100
     cacttccggc cggagttcct caaccgcatc gacgacgtga tcgtgttcca ccagctcacc      2160
     gaggccgaga tcatccagat ggtcgacctg ctcggtgcga gggtggaaaa ggccctcaag      2220
     ggcaaggaca tgtcgctgga gctgaccacg ctggccaaga agctgctggc caagcgcggg      2280
     ttcgacccgg tgctgggggc ccggccgttg cgccggacca tccagcgcga gatcgaggac      2340
     aggctctcgg agaagatcct gttcggcgag atcgagcccg gccagatcgt catcgtcgac      2400
     gtcgagggct gggacggcga gggctccgac gacaaggccc acttcacctt ccgcggtgag      2460
     accaagccgt cgctggtgcc cgacgcccca ccggtcgacc tcgccggctc caccggctcg      2520
     tcgaccgacg acaagtcgga aggcacctcc gaccaggagt ga                         2562
//

If you have problems or comments...

PBIL Back to PBIL home page