(data stored in SCRATCH zone)

EMBL: AM420293.CVNB1

AM420293.CVNB1       Location/Qualifiers
FT   CDS_pept        762088..762528
FT                   /transl_table=11
FT                   /gene="cvnB1"
FT                   /locus_tag="SACE_0691"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized distant relative of homeotic
FT                   protein bithoraxoid"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00033"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K9"
FT                   /protein_id="CAM00033.1"
FT                   /translation="MTAQETISRRFGWLVTDFTERVAGVAHAIVVSADGLLLTASAKLP
FT                   RDRADQLAAVASGLLSLTQGSAKCFEAGQVIQTVVEMQRGTLLQMGISDGSCLTVLAAP
FT                   QCDMGLIAYEMTMLVERVGQMLTPEIRSQLQGSPGAPTGQLV"
     atgactgccc aggagacgat ttcgcgcagg ttcggctggc tggtcacgga cttcaccgag        60
     cgcgtggccg gtgtggccca cgcgatcgtc gtgtcggccg acggcctgct gctcactgcg       120
     tcggcgaagc tgccgcggga ccgcgccgac cagctcgccg ccgtggcgtc gggcctgctg       180
     agcctgacgc agggctcggc gaagtgcttc gaggccggac aggtcatcca gaccgtcgtg       240
     gagatgcagc gcggcaccct gctgcagatg ggcatcagcg atggttcctg cctgaccgtg       300
     ctcgcggcgc cgcagtgcga catgggtctg atcgcctacg agatgaccat gctcgtcgag       360
     cgcgtcggtc agatgctcac cccggagatc cgttcgcagc tgcagggctc accaggcgca       420
     ccaaccggtc agctggtgtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page