(data stored in ACNUC1104 zone)

EMBL: AM420293.CVNB7

AM420293.CVNB7       Location/Qualifiers
FT   CDS_pept        617365..617772
FT                   /transl_table=11
FT                   /gene="cvnB7"
FT                   /locus_tag="SACE_0558"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized distant relative of homeotic
FT                   protein bithoraxoid"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99904"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A4F780"
FT                   /protein_id="CAL99904.1"
FT                   /translation="MSSNSFSWLITDFVRRVPGVAHSVVVSADGLLLAGSQGLPRDRAE
FT                   QLSAVASGLVSLTQGAARCFEAGDVTQTVVEMEQGYLFLMSISDGSCLAVLAAPNADIG
FT                   LVAYEMTLLVERVGRQLTPELRAQLQGMGRR"
     atgagcagca acagcttcag ttggctgatc accgatttcg tgcgccgcgt cccgggcgtc        60
     gcgcactccg tggtggtctc cgcggacggc ctgttgctgg caggctccca gggactgccg       120
     cgcgaccgcg ccgagcagct gtccgccgtc gcctccgggc tggtcagcct cacccagggc       180
     gcggcgcgct gcttcgaggc cggtgatgtc acccagaccg tcgtggagat ggagcagggc       240
     tacctgttcc tgatgtcgat cagcgacggt tcgtgcctcg cggtgctggc cgcgccgaac       300
     gccgacatcg gtctggtggc ctacgagatg acgctgctcg tggagcgggt cggccggcag       360
     ctcaccccgg agctgcgcgc ccagctccag ggcatgggtc gacggtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page