(data stored in ACNUC1104 zone)

EMBL: AM420293.CYDB

AM420293.CYDB        Location/Qualifiers
FT   CDS_pept        169496..170506
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SACE_0143"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /function="Cytochrome bd-type quinol oxidase, subunit 2"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99496"
FT                   /db_xref="GOA:A4F622"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A4F622"
FT                   /protein_id="CAL99496.1"
FT                   /translation="MDLPTVWFCLIALLWLGYLFLEGFDFGVGMLLPFLGREESERRVM
FT                   INTIGPVWDGNEVWLIVAAGATFAAFPGWYASLLSTAYLPFLVLLLALIGRGVAFEYRG
FT                   KVDSDRWRRGWDTVIVLASWISPLVVGLVLSANVFGLPLDANGDRVGGLLGIFSLPSVV
FT                   GALAVCGFALLHGAFFVTLKTEGDLRVRARKFALRLGVPLLLPVTALVLIAQFTQGTAW
FT                   TWVPLVIAVLAAAAGFLRLRGWRDGQAFALQGVALAAVVVGLFGTLWPNVLPSTLDPAW
FT                   SLSVAGTASSPYTLAVITWVAAFGTPAVLVYQGWTYWVFRKRIGTKHIPKVHAPS"
     atggatctgc ccacggtctg gttctgcctg atcgctctgc tgtggctggg ctacctgttc        60
     ctggagggct tcgacttcgg cgtcggcatg ctgctgccgt tcctcggacg cgaggagtcc       120
     gagcggcgcg tcatgatcaa cacgatcggg ccggtgtggg acggcaacga ggtgtggctg       180
     atcgtcgcgg cgggcgcgac gttcgccgcc ttccccggct ggtacgcctc gctgctgagc       240
     accgcctacc tgccgttcct ggtgctgctg ctggcgctca tcgggcgcgg ggtggccttc       300
     gagtaccgcg gaaaggtgga cagcgaccgc tggcggcgcg gctgggacac cgtgatcgtg       360
     ctggcgtcgt ggatctcgcc gctggtcgtc ggcctggtgc tctcggccaa cgtcttcggc       420
     ctgccgctgg acgccaacgg cgaccgggtg ggcggcctgc tcgggatctt ctcgctgccg       480
     agcgtggtcg gcgcgctggc ggtgtgcggg ttcgccctcc tgcacggcgc gttcttcgtg       540
     acgctgaaga cagagggaga cctgcgggtg cgggcccgca agttcgcgct gcggctcggc       600
     gtcccgctgc tgctgccggt caccgcgctg gtgctgatcg cgcagttcac ccagggcacc       660
     gcgtggacgt gggtgccgct ggtgatcgcg gtgcttgccg ctgcggccgg gttcctgcgc       720
     ctgcgcggct ggcgtgacgg gcaggcgttc gcgttgcagg gcgtcgcgct ggccgccgtc       780
     gtcgtcggcc tgttcggcac gttgtggccg aacgtgctgc cgtccactct ggacccggcg       840
     tggtcgctgt cggtcgccgg aaccgcgtcg agcccctaca cgctggcggt catcacgtgg       900
     gtagcggcgt tcggcacccc ggcggtgctg gtctaccagg gctggaccta ctgggtgttc       960
     cgcaagcgga tcggcaccaa gcacatcccg aaggtgcacg cgccctcatg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page